Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.76
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
psoriasis 6694 2.5e-04
ependymoma 4679 7.8e-04
osteosarcoma 7950 5.2e-03
oligodendroglioma 2850 2.0e-02
Disease Target Count Z-score Confidence
Muscular atrophy 71 3.344 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 7.8e-04
oligodendroglioma -1.200 2.0e-02
osteosarcoma 1.065 5.2e-03
ovarian cancer 2.100 1.3e-04
psoriasis -1.700 2.5e-04

AA Sequence

MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRL      1 - 70
PTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGII     71 - 140
CERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS                      141 - 192
//

Text Mined References (12)

PMID Year Title