Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.98
PubTator Score 11.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.700 3.1e-04
osteosarcoma -1.436 1.6e-05
medulloblastoma, large-cell -1.100 2.0e-04
Atopic dermatitis 1.100 1.9e-02
adult high grade glioma -1.300 4.6e-04

Gene RIF (7)

PMID Text
26076356 Gene dosage at 19p13.12, and AKAP8 and/or AKAP8L in particular, play an important role in modulation of head size and may contribute to autism risk.
25034436 HAP95 is incorporated into HIV-1 Gag/Gag-Pol virus-like particle instead of HIV-1 Gag virus-like particle, suggesting a role of Pol in the incorporation of HAP95 into virus particles
22190034 HAP95 is incorporated into HIV-1 Gag/Gag-Pol virus-like particle instead of HIV-1 Gag virus-like particle, suggesting a role of Pol in the incorporation of HAP95 into virus particles
18313049 These results infer that RNF43 is a resident protein of the ER and, at least partially, the nuclear membrane, with ubiquitin ligase activity and may be involved in cell growth control potentially through the interaction with HAP95.
17594903 Nuclear PKA C subunit co-locates with HA95 in splicing factor compartments and regulates pre-mRNA splicing, possibly through a cAMP-independent mechanism.
16391387 NAKAP-HypA scaffold is a potential nuclear docking site for huntingtin protein and may contribute to the nuclear accumulation of huntingtin observed in HD
12950172 Results indicate that in vitro, the interaction between HA95 and LAP2beta is influenced by a PKA-mediated phosphorylation of HA95 rather than by CDK1- or PKC-mediated phosphorylation of LAP2beta

AA Sequence

MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYGYGMATSHSWE      1 - 70
MPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLY     71 - 140
RSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQ    141 - 210
CMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQ    211 - 280
GGSPDEPDSKATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKG    281 - 350
ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV    351 - 420
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIHQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLF    421 - 490
IPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLERYLKGENPFTDSPEEEKEQE    491 - 560
EAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAVSPPPPPPPEEEEEGAVPLLGGALQRQIRGI    561 - 630
PGLDVEDDEEGGGGAP                                                          631 - 646
//

Text Mined References (37)

PMID Year Title
26076356 2015 Reciprocal Relationship between Head Size, an Autism Endophenotype, and Gene Dosage at 19p13.12 Points to AKAP8 and AKAP8L.
25034436 2014 The role of A-kinase anchoring protein 95-like protein in annealing of tRNALys3 to HIV-1 RNA.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18313049 2008 A cancer-associated RING finger protein, RNF43, is a ubiquitin ligase that interacts with a nuclear protein, HAP95.
17594903 2007 Involvement of the catalytic subunit of protein kinase A and of HA95 in pre-mRNA splicing.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16980585 2006 A novel histone deacetylase pathway regulates mitosis by modulating Aurora B kinase activity.
16391387 2005 Interaction of the nuclear matrix protein NAKAP with HypA and huntingtin: implications for nuclear toxicity in Huntington's disease pathogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12950172 2003 In vitro modulation of the interaction between HA95 and LAP2beta by cAMP signaling.
12538639 2003 HA95 and LAP2 beta mediate a novel chromatin-nuclear envelope interaction implicated in initiation of DNA replication.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
11884601 2002 Protein kinase A associates with HA95 and affects transcriptional coactivation by Epstein-Barr virus nuclear proteins.
11402034 2001 Mapping the functional domains of HAP95, a protein that binds RNA helicase A and activates the constitutive transport element of type D retroviruses.
11160753 2001 EBNA-LP associates with cellular proteins including DNA-PK and HA95.
11034899 2000 HA95 is a protein of the chromatin and nuclear matrix regulating nuclear envelope dynamics.
10761695 2000 Identification, cloning and characterization of a novel nuclear protein, HA95, homologous to A-kinase anchoring protein 95.
10748171 2000 A novel shuttle protein binds to RNA helicase A and activates the retroviral constitutive transport element.
10697960 2000 cDNA cloning of a novel human gene NAKAP95, neighbor of A-kinase anchoring protein 95 (AKAP95) on chromosome 19p13.11-p13.12 region.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.