Property Summary

NCBI Gene PubMed Count 31
PubMed Score 22.58
PubTator Score 22.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.600 5.2e-05
osteosarcoma -2.538 7.9e-08
tuberculosis and treatment for 6 months 1.200 4.1e-05
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-03
lung cancer 1.200 2.5e-03
ovarian cancer 1.300 2.1e-04

Gene RIF (9)

PMID Text
26823747 Report expression of connexin 43 in ovarian cancer cells in G1/S phase.
26683827 The data indicate that AKAP95 is a novel nucleolus-associated protein with a regulatory role on rRNA production.
26076356 Gene dosage at 19p13.12, and AKAP8 and/or AKAP8L in particular, play an important role in modulation of head size and may contribute to autism risk.
25770215 These results suggest that AKAP8 is involved in the regulation of chromatin structural changes through nuclear tyrosine phosphorylation.
23995757 Ectopic AKAP95 stimulates expression of a chromosomal reporter gene in synergy with MLL1 or MLL2, whereas AKAP95 depletion impairs retinoic acid-mediated gene induction in embryonic stem cells
22944692 Positional proteomics analysis identifies the cleavage of human A kinase (PRKA) anchor protein 8 (AKAP8) at amino acid residues 310-311 by the HIV-1 protease
16227597 AKAP95 is a potential carrier protein for active caspase 3 from the cytoplasm into the nuclei in apoptotic cells.
12740381 role of AKAP95 in DNA replication by providing a scaffold for MCM2
12414807 AMY-1 interacts with S-AKAP84 and this protein in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.

AA Sequence

MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAA      1 - 70
GAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCL     71 - 140
PEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPF    141 - 210
VPPAASSEPLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQP    211 - 280
RMRDRDRPKRRGFDRFGPDGTGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDEL    281 - 350
CDSGRQRGEKEDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF    351 - 420
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPA    421 - 490
QPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDN    491 - 560
LGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVP    561 - 630
CGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE            631 - 692
//

Text Mined References (45)

PMID Year Title
26880274 2016 Dynamic changes in protein interaction between AKAP95 and Cx43 during cell cycle progression of A549 cells.
26823747 2015 Roles of Cx43 and AKAP95 in ovarian cancer tissues in G1/S phase.
26683827 2016 A-kinase anchoring protein AKAP95 is a novel regulator of ribosomal RNA synthesis.
26076356 2015 Reciprocal Relationship between Head Size, an Autism Endophenotype, and Gene Dosage at 19p13.12 Points to AKAP8 and AKAP8L.
25770215 2015 Role for Tyrosine Phosphorylation of A-kinase Anchoring Protein 8 (AKAP8) in Its Dissociation from Chromatin and the Nuclear Matrix.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23995757 2013 Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22130794 2012 Localization and retention of p90 ribosomal S6 kinase 1 in the nucleus: implications for its function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19277197 2009 A-kinase anchoring in dendritic cells is required for antigen presentation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16980585 2006 A novel histone deacetylase pathway regulates mitosis by modulating Aurora B kinase activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16227597 2005 A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association.
15470020 2004 A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14641107 2004 A novel partner for D-type cyclins: protein kinase A-anchoring protein AKAP95.
12740381 2003 Protein kinase A-anchoring protein AKAP95 interacts with MCM2, a regulator of DNA replication.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414807 2002 AMY-1 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.
11964380 2002 Distinct but overlapping domains of AKAP95 are implicated in chromosome condensation and condensin targeting.
11807172 2002 AKAP mediated signal transduction.
11591814 2001 Regulation of anchoring of the RIIalpha regulatory subunit of PKA to AKAP95 by threonine phosphorylation of RIIalpha: implications for chromosome dynamics at mitosis.
11279182 2001 A-kinase-anchoring protein AKAP95 is targeted to the nuclear matrix and associates with p68 RNA helicase.
10791967 2000 A kinase-anchoring protein (AKAP)95 recruits human chromosome-associated protein (hCAP)-D2/Eg7 for chromosome condensation in mitotic extract.
10764601 2000 Analysis of A-kinase anchoring protein (AKAP) interaction with protein kinase A (PKA) regulatory subunits: PKA isoform specificity in AKAP binding.
10601332 1999 The A-kinase-anchoring protein AKAP95 is a multivalent protein with a key role in chromatin condensation at mitosis.
9473338 1998 Molecular cloning, chromosomal localization, and cell cycle-dependent subcellular distribution of the A-kinase anchoring protein, AKAP95.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.