Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.90
PubTator Score 8.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group A ependymoma -2.500 3.2e-14
glioblastoma -1.700 2.8e-08
osteosarcoma 1.532 3.4e-03
atypical teratoid/rhabdoid tumor -2.000 3.5e-08
primitive neuroectodermal tumor -1.200 6.4e-03
colon cancer -1.200 7.9e-03
pediatric high grade glioma -1.500 5.0e-08
group 3 medulloblastoma -2.300 3.9e-06
pilocytic astrocytoma -1.400 7.6e-08
ovarian cancer -1.200 4.7e-07
pituitary cancer 1.300 1.6e-07

Gene RIF (7)

PMID Text
26563778 Findings indicate a interplay between A-kinase anchoring protein 6 (AKAP6) and myogenin.
23806656 Comparative analysis of the binding responses of mutations to mAKAP could provide important information about how these mutations modulate PKA and PDE4D3 signaling.
22484155 This study expands our understanding of the regulation of MEF2 in skeletal muscle and identifies the mAKAP scaffold as a facilitator of MEF2 transcription and myogenic differentiation.
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20106966 cAMP-stimulated protein phosphatase 2A activity associated with muscle A kinase-anchoring protein (mAKAP) signaling complexes inhibits the phosphorylation and activity of the cAMP-specific phosphodiesterase PDE4D3
19109240 mAKAP organized ubiquitin E3 ligases that managed the stability of HIF-1alpha and optimally positioned it close to its site of action inside the nucleus

AA Sequence

MLTMSVTLSPLRSQDLDPMATDASPMAINMTPTVEQGEGEEAMKDMDSDQQYEKPPPLHTGADWKIVLHL      1 - 70
PEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQIHALLETEFSLKLLSYSVNV     71 - 140
IVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDILQAFSEETKEGRLDSLTEVDDSGQLTIK    141 - 210
CSQNYLSLDCGITAFELSDYSPSEDLLSGLGDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVAAD    211 - 280
SISTNGSEAVTEEVSQVSLSVDDKGGCEEDNASAVEEQPGLTLGVSSSSGEALTNAAQPSSETVQQESSS    281 - 350
SSHHDAKNQQPVPCENATPKRTIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNDLKGNGGKRQMVDLKPE    351 - 420
MSRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIKEISSSLGRLNDCYK    421 - 490
EKSRLKKPHKTSEEVPPCRTPKRGTGSGKQAKNTKSSAVPNGELSYTSKAIEGPQTNSASTSSLEPCNQR    491 - 560
SWNAKLQLQSETSSSPAFTQSSESSVGSDNIMSPVPLLSKHKSKKGQASSPSHVTRNGEVVEAWYGSDEY    561 - 630
LALPSHLKQTEVLALKLENLTKLLPQKPRGETIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSS    631 - 700
SSDIASSLGESIESGPLSDILSDEESSMPLAGMKKYADEKSERASSSEKNESHSATKSALIQKLMQDIQH    701 - 770
QDNYEAIWEKIEGFVNKLDEFIQWLNEAMETTENWTPPKAEMDDLKLYLETHLSFKLNVDSHCALKEAVE    771 - 840
EEGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPK    841 - 910
AEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGSNGLLDFDSEYQELWDWLIDMES    911 - 980
LVMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKVEALKKGGVLLPNDLLEKVDSINEKWELLGK    981 - 1050
TLGEKIQDTMAGHSGSSPRDLLSPESGSLVRQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNTEKQL   1051 - 1120
QYFKSLCREIKQRRRGVASILRLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQK   1121 - 1190
KMGKESETLNVIDPGLMDLNGMSEDALEWDEMDISNKLISLNEESNDLDQELQPVIPSLKLGETSNEDPG   1191 - 1260
YDEEADNHGGSQYASNITAPSSPHIYQVYSLHNVELYEDNHMPFLKNNPKVTGMTQPNVLTKSLSKDSSF   1261 - 1330
SSTKSLPDLLGGSNLVKPCACHGGDMSQNSGSESGIVSEGDTETTTNSEMCLLNAVDGSPSNLETEHLDP   1331 - 1400
QMGDAVNVLKQKFTDEGESIKLPNSSQSSISPVGCVNGKVGDLNSITKHTPDCLGEELQGKHDVFTFYDY   1401 - 1470
SYLQGSKLKLPMIMKQSQSEKAHVEDPLLRGFYFDKKSCKSKHQTTELQPDVPPHERILASASHEMDRIS   1471 - 1540
YKSGNIEKTFTGMQNAKQLSLLSHSSSIESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLF   1541 - 1610
SCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFTGQMSLDIASSI   1611 - 1680
NEDSAASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNVSCTSACTDDE   1681 - 1750
DDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEDCTLMSGLDYIKNELQTWIRPKLSLTRDKKRCN   1751 - 1820
VSDEMKGSKDISSSEMTNPSDTLNIETLLNGSVKRVSENNGNGKNSSHTHELGTKRENKKTIFKVNKDPY   1821 - 1890
VADMENGNIEGIPERQKGKPNVTSKVSENLGSHGKEISESEHCKCKALMDSLDDSNTAGKEFVSQDVRHL   1891 - 1960
PKKCPNHHHFENQSTASTPTEKSFSELALETRFNNRQDSDALKSSDDAPSMAGKSAGCCLALEQNGTEEN   1961 - 2030
ASISNISCCNCEPDVFHQKDAEDCSVHNFVKEIIDMASTALKSKSQPENEVAAPTSLTQIKEKVLEHSHR   2031 - 2100
PIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPLDTTDSGLDDKEDIECFFEACVEGDSDGEEPC   2101 - 2170
FSSAPPNESAVPSEAAMPLQATACSSEFSDSSLSADDADTVALSSPSSQERAEVGKEVNGLPQTSSGCAE   2171 - 2240
NLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLH   2241 - 2310
EKRHRNMHR                                                                2311 - 2319
//

Text Mined References (33)

PMID Year Title
26563778 2015 AKAP6 inhibition impairs myoblast differentiation and muscle regeneration: Positive loop between AKAP6 and myogenin.
23806656 2013 Protein kinase A and phosphodiesterase-4D3 binding to coding polymorphisms of cardiac muscle anchoring protein (mAKAP).
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22566634 2012 The genetic architecture of economic and political preferences.
22484155 2012 Myocyte enhancer factor 2 (MEF2) tethering to muscle selective A-kinase anchoring protein (mAKAP) is necessary for myogenic differentiation.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20106966 2010 cAMP-stimulated protein phosphatase 2A activity associated with muscle A kinase-anchoring protein (mAKAP) signaling complexes inhibits the phosphorylation and activity of the cAMP-specific phosphodiesterase PDE4D3.
19109240 2008 mAKAP compartmentalizes oxygen-dependent control of HIF-1alpha.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17923693 2007 Protein kinase A, Ca2+/calmodulin-dependent kinase II, and calcineurin regulate the intracellular trafficking of myopodin between the Z-disc and the nucleus of cardiac myocytes.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16177794 2005 The protein kinase A anchoring protein mAKAP coordinates two integrated cAMP effector pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754202 2003 Sodium/calcium exchanger (NCX1) macromolecular complex.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11807172 2002 AKAP mediated signal transduction.
11590243 2001 mAKAP and the ryanodine receptor are part of a multi-component signaling complex on the cardiomyocyte nuclear envelope.
11352932 2001 Phosphorylation-dependent regulation of ryanodine receptors: a novel role for leucine/isoleucine zippers.
11299204 2001 AKAP proteins anchor cAMP-dependent protein kinase to KvLQT1/IsK channel complex.
11296225 2001 mAKAP assembles a protein kinase A/PDE4 phosphodiesterase cAMP signaling module.
10830164 2000 PKA phosphorylation dissociates FKBP12.6 from the calcium release channel (ryanodine receptor): defective regulation in failing hearts.
10413680 1999 mAKAP: an A-kinase anchoring protein targeted to the nuclear membrane of differentiated myocytes.
9679148 1998 A-kinase anchoring protein 100 (AKAP100) is localized in multiple subcellular compartments in the adult rat heart.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
7721854 1995 Cloning and characterization of A-kinase anchor protein 100 (AKAP100). A protein that targets A-kinase to the sarcoplasmic reticulum.