Property Summary

NCBI Gene PubMed Count 62
PubMed Score 121.60
PubTator Score 110.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.400 1.4e-03
ependymoma -2.700 3.6e-15
oligodendroglioma -2.000 7.6e-03
glioblastoma -2.900 1.1e-05
medulloblastoma -2.800 4.6e-08
atypical teratoid / rhabdoid tumor -2.700 1.7e-07
medulloblastoma, large-cell -2.900 7.2e-04
primitive neuroectodermal tumor -2.000 2.4e-03
tuberculosis and treatment for 3 months -1.100 2.2e-03
pediatric high grade glioma -2.400 6.0e-06
pilocytic astrocytoma -2.100 4.4e-05
lung carcinoma -1.100 4.1e-09

Protein-protein Interaction (5)

Gene RIF (30)

PMID Text
25882844 human AKAP79-anchored PKC selectively phosphorylates the Robo3.1 receptor subtype on serine 1330
25637608 Cigarette smoke-induced changes in AKAP5 and AKAP12 in patients with COPD may affect efficacy of pharmacotherapy.
24962572 GPR30 interacted with membrane-associated guanylate kinases and protein kinase A-anchoring protein (AKAP) 5 in the plasma membrane in a PDZ-dependent manner.
24121510 a significant role for the AKAP5 scaffold in signaling and trafficking of the beta1-AR in cardiac myocytes and mammalian cells.
23889134 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23699529 The results of this study suggested that antagonizing the TRPV1-AKAP79 interaction will be a useful strategy for inhibiting inflammatory hyperalgesia.
23616546 Antagonizing the interaction between AKAP79 and TRPV1 inhibits inflammatory hyperalgesia.
23462372 Patients with bipolar disorder have higher density of AKAP5-expressing neurons in the anterior cingulate cortex compared with controls.
23383244 AKAP5 Pro100Leu effects on emotion processing might be task-dependent with Pro homozygotes showing lower control of emotional interference, but more efficient processing of task-relevant emotional stimuli.
23264624 the direct anchoring of both PKA and AC to TRPV1 by AKAP79/150 facilitates the response to inflammatory mediators and may be critical in the pathogenesis of thermal hyperalgesia.
22693956 We demonstrate that calmodulin and caldendrin compete for a partially overlapping binding site on AKAP79 and that their binding is differentially dependent on calcium
22677788 AKAP79 directly interacts with Cav1.2 c-terminus and modulates Cav1.2 membrane targeting.
22623657 results reveal novel roles for the AKAP79/150 signaling complex in dendritic endosomes.
22343722 show that an IAIIIT anchoring site in human AKAP79 binds the same surface of calcineurin as the PxIxIT recognition peptide of NFAT, albeit more strongly
21771783 Mutation of the two critical cysteines results in exclusion of AKAP79 from lipid rafts and alterations in its membrane diffusion behavior and is accompanied by a loss of the ability of AKAP79 to regulate AC8.
21464287 dimeric AKAP79 concentrates pockets of second messenger responsive enzyme activities at the plasma membrane.
21221125 AKAP79 may be the key AKAPs responsible for regulating antigen presentation.
21156788 by favoring apoCaM binding to AKAP79, KN-62 and KN-93 derail the ability of AKAP79 to efficiently recruit PKC for regulation of GluA1. Thus, AKAP79 endows PKC with a pharmacological profile that overlaps with CaMKII.
20883492 Studies indicate that the cAMP signaling pathway is organized by A-kinase anchoring proteins and AKAP79 remainis the best-understood anchoring protein.
20410303 Data reveal that an association of the Ca(2+)-stimulable AC8 with AKAP79/150 that limits the sensitivity of AC8 to intracellular Ca(2+) events.
18950703 AKAP5 protein is associated with its G-protein-coupled receptor, at the cell membrane, docked with the receptor during agonist-induced internalization and later receptor recycling after agonist wash-out.
18305116 AKAP79 provides a mechanism to overcome limitations in kinase abundance thereby ensuring faithful signal propagation and efficient modification of AMPA receptor-mediated responses
17548344 AKAP150 and the protein phosphatase calcineurin are binding proteins to ASIC2a, and calcineurin regulates ASIC1a and ASIC2a activity
16973443 AKAP79 interacts with adenylyl cyclase V and adenylyl cyclase VI in a complex that associates with protein kinase A forming a negative feedback loop that termporally regulates cAMP production.
16940053 AKAP79 provides cyclic AMP-dependent protein kinase to phosphorylate the beta1-adrenergic receptor and thereby dictate the recycling and resensitization itineraries of the beta1-adrenergic receptor
15671033 there is a 13-amino acid region within CN that is essential for the interaction with NFAT and with two other CN-binding proteins, AKAP79 and Cabin-1
12938160 Data suggest that cyclic AMP/protein kinase A may be coupled with calcium/calmodulin and guanosine triphosphatases through an IQGAP1/AKAP79 complex.
12507994 AKAP79 has a role in organizing large signalling complexes
12114507 Trafficking of L-type calcium channels is mediated by the postsynaptic scaffolding protein AKAP79.
12077483 that during prenatal development AKAP79 expression increased gradually in the red nucleus

AA Sequence

METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASD      1 - 70
QPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSN     71 - 140
HSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVI    141 - 210
SVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEA    211 - 280
SNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEF    281 - 350
DVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN    351 - 420
KINNLLQ                                                                   421 - 427
//

Text Mined References (64)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25882844 2015 A-kinase Anchoring Protein 79/150 Recruits Protein Kinase C to Phosphorylate Roundabout Receptors.
25637608 2015 A-kinase-anchoring proteins coordinate inflammatory responses to cigarette smoke in airway smooth muscle.
24962572 2014 G protein-coupled receptor 30 (GPR30) forms a plasma membrane complex with membrane-associated guanylate kinases (MAGUKs) and protein kinase A-anchoring protein 5 (AKAP5) that constitutively inhibits cAMP production.
24121510 2013 Role of AKAP79/150 protein in ?1-adrenergic receptor trafficking and signaling in mammalian cells.
23889134 2013 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23699529 2013 Mapping the binding site of TRPV1 on AKAP79: implications for inflammatory hyperalgesia.
23616546 2013 Disrupting sensitization of transient receptor potential vanilloid subtype 1 inhibits inflammatory hyperalgesia.
23462372 2013 Increased density of AKAP5-expressing neurons in the anterior cingulate cortex of subjects with bipolar disorder.
23383244 2013 Effects of AKAP5 Pro100Leu genotype on working memory for emotional stimuli.
23264624 2013 Scaffolding by A-kinase anchoring protein enhances functional coupling between adenylyl cyclase and TRPV1 channel.
22693956 2012 AKAP79/150 interacts with the neuronal calcium-binding protein caldendrin.
22677788 AKAP79 modulation of L-type channels involves disruption of intramolecular interactions in the CaV1.2 subunit.
22623657 2012 Palmitoylation of A-kinase anchoring protein 79/150 regulates dendritic endosomal targeting and synaptic plasticity mechanisms.
22343722 2012 Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling.
21771783 2011 Palmitoylation targets AKAP79 protein to lipid rafts and promotes its regulation of calcium-sensitive adenylyl cyclase type 8.
21464287 2011 Architecture and dynamics of an A-kinase anchoring protein 79 (AKAP79) signaling complex.
21221125 2011 AKAPs in lipid rafts are required for optimal antigen presentation by dendritic cells.
21156788 2011 Ca2+/calmodulin-dependent protein kinase II inhibitors disrupt AKAP79-dependent PKC signaling to GluA1 AMPA receptors.
20883492 2010 Organizing signal transduction through A-kinase anchoring proteins (AKAPs).
20664520 2010 Sub-picomolar relaxin signalling by a pre-assembled RXFP1, AKAP79, AC2, beta-arrestin 2, PDE4D3 complex.
20410303 2010 AKAP79/150 interacts with AC8 and regulates Ca2+-dependent cAMP synthesis in pancreatic and neuronal systems.
18950703 2009 G-protein-coupled receptor-associated A-kinase anchoring proteins AKAP5 and AKAP12: differential trafficking and distribution.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18305116 2008 AKAP79 selectively enhances protein kinase C regulation of GluR1 at a Ca2+-calmodulin-dependent protein kinase II/protein kinase C site.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17548344 2007 A kinase-anchoring protein 150 and calcineurin are involved in regulation of acid-sensing ion channels ASIC1a and ASIC2a.
17081159 2006 Role of protein kinase C-dependent A-kinase anchoring proteins in lysophosphatidic acid-induced cAMP signaling in human diploid fibroblasts.
16973443 2006 Dynamic regulation of cAMP synthesis through anchored PKA-adenylyl cyclase V/VI complexes.
16940053 2006 AKAP79-mediated targeting of the cyclic AMP-dependent protein kinase to the beta1-adrenergic receptor promotes recycling and functional resensitization of the receptor.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15671033 2005 The linker region joining the catalytic and the regulatory domains of CnA is essential for binding to NFAT.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12938160 2003 Identification of an IQGAP1/AKAP79 complex in beta-cells.
12672969 2003 Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein kinase A anchoring.
12595241 2003 A-kinase anchoring protein 79/150 facilitates the phosphorylation of GABA(A) receptors by cAMP-dependent protein kinase via selective interaction with receptor beta subunits.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12507994 2003 Imaging kinase--AKAP79--phosphatase scaffold complexes at the plasma membrane in living cells using FRET microscopy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177200 2002 Regulation of A-kinase anchoring protein 79/150-cAMP-dependent protein kinase postsynaptic targeting by NMDA receptor activation of calcineurin and remodeling of dendritic actin.
12114507 2002 Trafficking of L-type calcium channels mediated by the postsynaptic scaffolding protein AKAP79.
12077483 Expression of a kinase anchoring protein 79 and synaptophysin in the developing human red nucleus.
11886862 2002 Novel mechanism of regulation of Rac activity and lamellipodia formation by RET tyrosine kinase.
11823486 2002 Identification and characterization of myeloid translocation gene 16b as a novel a kinase anchoring protein in T lymphocytes.
11807172 2002 AKAP mediated signal transduction.
11557526 2001 Association of protein kinase A with AKAP150 facilitates pepsinogen secretion from gastric chief cells.
11287423 2001 Targeting of an A kinase-anchoring protein, AKAP79, to an inwardly rectifying potassium channel, Kir2.1.
11179200 2001 Membrane-bound protein kinase A inhibits smooth muscle cell proliferation in vitro and in vivo by amplifying cAMP-protein kinase A signals.
10939335 2000 Targeting of PKA to glutamate receptors through a MAGUK-AKAP complex.
10762347 2000 Localization of the A kinase anchoring protein AKAP79 in the human hippocampus.
10753752 2000 Assembly of an A kinase-anchoring protein-beta(2)-adrenergic receptor complex facilitates receptor phosphorylation and signaling.
10537145 1999 Protein kinase A anchoring to the myometrial plasma membrane is required for cyclic adenosine 3',5'-monophosphate regulation of phosphatidylinositide turnover.
10037748 1999 The type and the localization of cAMP-dependent protein kinase regulate transmission of cAMP signals to the nucleus in cortical and cerebellar granule cells.
9765270 1998 AKAP79 inhibits calcineurin through a site distinct from the immunophilin-binding region.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.
9202019 1997 Regulation of the AKAP79-protein kinase C interaction by Ca2+/Calmodulin.
8509414 1993 Characterization of distinct tethering and intracellular targeting domains in AKAP75, a protein that links cAMP-dependent protein kinase II beta to the cytoskeleton.
7528941 1995 Association of protein kinase A and protein phosphatase 2B with a common anchoring protein.
1860836 1991 Interaction of the regulatory subunit (RII) of cAMP-dependent protein kinase with RII-anchoring proteins occurs through an amphipathic helix binding motif.
1733921 1992 Cloning and expression of an intron-less gene for AKAP 75, an anchor protein for the regulatory subunit of cAMP-dependent protein kinase II beta.
1618839 1992 Association of the type II cAMP-dependent protein kinase with a human thyroid RII-anchoring protein. Cloning and characterization of the RII-binding domain.
1512224 1992 Localization of the cAMP-dependent protein kinase to the postsynaptic densities by A-kinase anchoring proteins. Characterization of AKAP 79.