Property Summary

NCBI Gene PubMed Count 21
PubMed Score 90.34
PubTator Score 48.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.2e-06
Disease Target Count Z-score Confidence
Male infertility 170 4.391 2.2
Infertility 163 3.543 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 1.2e-06

 GO Function (1)

Gene RIF (9)

PMID Text
26590805 AKAP4 appears to be a novel Colorectal cancer-associated antigen with a potential for developing as a new clinical therapeutic target
26160834 AKAP4 is a highly accurate biomarker for the detection of early stage lung cancer.
25739119 SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients.
23764900 Ablation of AKAP4 protein caused significant inhibition in cellular proliferation, colony-forming ability, migration and invasion ability of tumor cells.
23478221 The putative role of AKAP4 in early tumorigenesis is implicated as a biomarker and immunotherapeutic target for cervical cancer.
23451156 data suggests that AKAP4 may be used as serum based diagnostic test for an early detection and diagnosis of breast cancer and may be a potential target for immunotherapeutic use
21520158 We demonstrate the aberrant expression of AKAP-4 in prostate cancer, which will potentially be developed as a biomarker in prostate cancer.
17712481 Role of AKAP4 in sperm motility is unclear, vut absent or weak AKAP4-labelling is associated with absent or weak sperm. motility.
17683036 AKAP4 is a novel target for protein S-nitrosylation in spermatozoa.

AA Sequence

MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLN      1 - 70
LGSLEEKEIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLNWLLSDLQKYALGFQHALSPSTSTCKHKV     71 - 140
GDTEGEYHRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAAKNTNNNQSPSAPPAKPPSTQRAVISPDG    141 - 210
ECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVE    211 - 280
LTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMK    281 - 350
TLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNAT    351 - 420
DIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSL    421 - 490
TSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQT    491 - 560
KGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIV    561 - 630
LMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKL    631 - 700
VESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSL    701 - 770
QKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGK    771 - 840
VARKQLLDWLLANL                                                            841 - 854
//

Text Mined References (21)

PMID Year Title
26590805 2015 A-kinase anchor protein 4 (AKAP4) a promising therapeutic target of colorectal cancer.
26160834 2015 AKAP4 is a circulating biomarker for non-small cell lung cancer.
25739119 2015 Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.
23764900 2013 Gene silencing of A-kinase anchor protein 4 inhibits cervical cancer growth in vitro and in vivo.
23478221 2013 Expression and humoral response of A-kinase anchor protein 4 in cervical cancer.
23451156 2013 A novel cancer testis antigen, A-kinase anchor protein 4 (AKAP4) is a potential biomarker for breast cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21520158 2012 Identification of AKAP-4 as a new cancer/testis antigen for detection and immunotherapy of prostate cancer.
17712481 2007 Localization of AKAP4 and tubulin proteins in sperm with reduced motility.
17683036 2007 Human spermatozoa contain multiple targets for protein S-nitrosylation: an alternative mechanism of the modulation of sperm function by nitric oxide?
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12606363 2003 A-kinase anchoring protein 4 binding proteins in the fibrous sheath of the sperm flagellum.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11807172 2002 AKAP mediated signal transduction.
11476771 2001 Molecular evaluation of two major human sperm fibrous sheath proteins, pro-hAKAP82 and hAKAP82, in stump tail sperm.
9852104 1998 Identification of tethering domains for protein kinase A type Ialpha regulatory subunits on sperm fibrous sheath protein FSC1.
9822690 1998 An X-linked gene encodes a major human sperm fibrous sheath protein, hAKAP82. Genomic organization, protein kinase A-RII binding, and distribution of the precursor in the sperm tail.
9514854 1998 Molecular cloning of human testis mRNA specifically expressed in haploid germ cells, having structural homology with the A-kinase anchoring proteins.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.