Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.42
PubTator Score 23.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Male infertility 170 3.809 1.9
Extrahepatic bile duct carcinoma 2 3.539 1.8

Expression

Synonym

Accession O75969 O75945 Q86X01 Q9UM61 AKAP-3
Symbols CT82
SOB1
FSP95
PRKA3
HEL159
AKAP110
AKAP 110

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (7)

PMID Text
26458542 AKAP3 correlates with triple negative status and disease free survival in breast cancer.
22941507 study reports the isolation of AKAP3 and CTp11 Cancer/testis antigens from hepatocellular carcinoma patient sera
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
17683036 AKAP3 is a novel target for protein S-nitrosylation in spermatozoa.
16005946 AKAP-3 demonstrates tumor-restricted expression and appears to be associated with worse overall survival.
14618620 In Cox multivariate analysis, AKAP3 mRNA expression was found to be a significant predictor of both overall and progression-free survival in patients with poorly differentiated tumors.
12509440 evidence of tyrosine phosphorylation during sperm capacitation

AA Sequence

MSEKVDWLQSQNGVCKVDVYSPGDNQAQDWKMDTSTDPVRVLSWLRRDLEKSTAEFQDVRFKPGESFGGE      1 - 70
TSNSGDPHKGFSVDYYNTTTKGTPERLHFEMTHKEIPCQGPRAQLGNGSSVDEVSFYANRLTNLVIAMAR     71 - 140
KEINEKIDGSENKCVYQSLYMGNEPTPTKSLSKIASELVNETVSACSRNAAPDKAPGSGDRVSGSSQSPP    141 - 210
NLKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEVFESRNGDYAREGGRFFPRERKRFRGQERPDDFTAS    211 - 280
VSEGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLLKHAKEVVSDLIDSFLRNLHSVTGTLMT    281 - 350
DTQFVSAVKRTVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNV    351 - 420
NFAMKSETKLREKMYSEPKSEEETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFEAPNTQRKPAS    421 - 490
DISFEYPEDIGNLSLPPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLAQGGRRDARSFVEAAGTTNFP    491 - 560
ANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCE    561 - 630
RPLASSPPRLYEDDETPGALSGLTKMAVSQIDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAELGDDKS    631 - 700
GDASRLTSAFPDSLYECLPAKGTGSAEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQN    701 - 770
KQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNV    771 - 840
TPLQLLDWLMVNL                                                             841 - 853
//

Text Mined References (24)

PMID Year Title
26458542 2015 AKAP3 correlates with triple negative status and disease free survival in breast cancer.
25820252 2015 Interactome of the negative regulator of nuclear import BRCA1-binding protein 2.
22941507 2012 Identification of the cancer/testis antigens AKAP3 and CTp11 by SEREX in hepatocellular carcinoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
17683036 2007 Human spermatozoa contain multiple targets for protein S-nitrosylation: an alternative mechanism of the modulation of sperm function by nitric oxide?
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16005946 2005 A-kinase anchoring protein 3 messenger RNA expression correlates with poor prognosis in epithelial ovarian cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15257753 2004 Association of sperm protein 17 with A-kinase anchoring protein 3 in flagella.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14618620 2004 A-kinase anchoring protein 3 messenger RNA expression in ovarian cancer and its implication on prognosis.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11807172 2002 AKAP mediated signal transduction.
11696326 2001 Interaction of heterotrimeric G13 protein with an A-kinase-anchoring protein 110 (AKAP110) mediates cAMP-independent PKA activation.
11278869 2001 Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.
10529264 1999 FSP95, a testis-specific 95-kilodalton fibrous sheath antigen that undergoes tyrosine phosphorylation in capacitated human spermatozoa.
10334916 1999 Cloning and characterization of SOB1, a new testis-specific cDNA encoding a human sperm protein probably involved in oocyte recognition.
10319321 1999 Isolation and molecular characterization of AKAP110, a novel, sperm-specific protein kinase A-anchoring protein.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.