Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 9.1e-10
nasopharyngeal carcinoma 1058 4.8e-08
Endometriosis 540 5.7e-03
psoriasis 6694 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Endometriosis -1.588 5.7e-03
ependymoma 3.800 9.1e-10
nasopharyngeal carcinoma -3.400 4.8e-08
psoriasis -1.300 1.2e-02

Synonym

Accession Q86UN6 A6NNZ0 Q86UN4 Q86UN5 AKAP-14
Symbols AKAP28
PRKA14

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIVEEERNPLKNIKWMTH      1 - 70
GEFTVEKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMK     71 - 140
VSKTKPPDAPIVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPFLFNRV                 141 - 197
//

Text Mined References (5)

PMID Year Title