Property Summary

NCBI Gene PubMed Count 66
PubMed Score 267.46
PubTator Score 96.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 2.100 2.6e-03
astrocytoma 2.200 3.1e-04
ependymoma 1.400 1.8e-03
oligodendroglioma 1.100 1.8e-03
psoriasis -3.100 3.9e-04
osteosarcoma 3.408 3.7e-09
atypical teratoid / rhabdoid tumor 2.200 9.2e-06
glioblastoma 2.500 1.7e-06
medulloblastoma 1.500 2.9e-03
medulloblastoma, large-cell 1.700 3.3e-03
primitive neuroectodermal tumor 1.700 3.6e-03
pancreatic ductal adenocarcinoma liver m... 2.132 4.2e-03
non-small cell lung cancer -1.254 9.1e-22
intraductal papillary-mucinous adenoma (... 1.500 2.4e-03
lung cancer -1.900 8.6e-05
pediatric high grade glioma 1.800 1.6e-05
pilocytic astrocytoma 1.400 1.3e-04
subependymal giant cell astrocytoma 2.156 2.2e-02
lung adenocarcinoma -1.700 3.2e-14
lung carcinoma -1.300 3.6e-23
Pick disease 1.400 3.0e-05
progressive supranuclear palsy 1.100 3.4e-02
ovarian cancer 3.100 6.4e-07
Gaucher disease type 1 -1.200 1.8e-02
pituitary cancer -1.500 4.1e-04
pancreatic cancer 1.400 2.5e-03

Gene RIF (37)

PMID Text
26617690 evaluation of MAGT1 and AKAP13 expression in clinical hepatocellular carcinoma tissues by immunohistochemistry suggested that both proteins were strongly expressed in tumor tissues with significantly higher average immunoreactive scores of Remmele and Stegner (IRS) than in non-tumor tissues
26272591 Studied molecular interactions involving anchoring protein AKAP13 in the process of PKA-induced tamoxifen resistance in breast cancer specimens and cell lines.
25186459 Isothermal titration calorimetry showed that AKAP-Lbc has only micromolar affinity for RhoA, which combined with the presence of potential binding pockets for small molecules on AKAP-Lbc, raises the possibility of targeting AKAP-Lbc with GEF inhibitors.
24993829 pleckstrin homology (PH) domain of Lbc is located at the C-terminal end of the protein and is shown here to specifically recognize activated RhoA rather than lipids
23090968 activation of IKKbeta within the AKAP-Lbc complex promotes NF-kappaB-dependent production of interleukin-6
23045525 Shp2 is a component of the AKAP-Lbc complex and is inhibited by protein kinase A under pathological hypertrophic conditions in the heart.
22731613 Thus AKAP-Lbc may serve an ancillary cardioprotective role by favouring the association of PKA with Hsp20.
22161024 Amplification of AKAP-13 is associated with metastatic and aggressive papillary thyroid carcinomas.
21228793 One SNP (rs11638762), in the GATA-3 binding site upstream of the AKAP13 gene, was significantly replicated in another cohort for systolic blood pressure
21224381 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation.
21102438 Study demonstrates that the A-kinase-anchoring protein AKAP-Lbc and the scaffolding protein kinase suppressor of Ras (KSR-1) form the core of a signalling network that efficiently relay signals from RAF, through MEK, and on to ERK1/2.
20719862 third new locus (rs6496932), on 15q25.3 (beta = 0.13, P = 1.4 x 10(-8)), was within a wide linkage disequilibrium block extending into the 5' end of the AKAP13 gene, encoding a scaffold protein concerned with signal transduction from the cell surface
20696764 the Lbc/alpha-catulin axis participates in 5-HT-induced PASMC mitogenesis and RhoA/ROCK signaling, and may be an interventional target in diseases involving vascular smooth muscle remodeling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20353833 Observational study of gene-disease association. (HuGE Navigator)
19960345 Data show that the RASGRP1/APTX gene expression ratio was higher in the responder while the AKAP13 expression was higher in the non-responders.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19888694 backbone and side chain (1)H, (13)C and (15)N resonance assignments of a 20 kDa construct comprising the uniformly (13)C and( 15)N labeled AKAP13-PH domain and an associated helix from the DH domain which is required for its stable expression
19779964 The positive expression rate of AKAP13 protein in colorectal carcinoma (52.3%) was significantly higher than those in adenoma (9.1%) and normal tissue (34.7%) (P = 0.006) by immunohistochemical staining.
19696020 Data suggest that LC3 binding maintains AKAP-Lbc in an inactive state that displays a reduced ability to promote downstream signaling.
18854154 Knockdown of A kinase (PRKA) anchor protein 13 (AKAP13) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18445682 findings show the BNIP2 & BCH domain of BNIPXL interacts with specific conformers of RhoA & mediates association with catalytic DH-PH domains of Lbc, a RhoA-specific guanine nucleotide exchange factor; BNIPXL inhibits Lbc-induced oncogenic transformation
18093280 Observational study of gene-disease association. (HuGE Navigator)
17878165 AKAP13 plays a role in TLR2-mediated NF-kappaB activation; GEF-containing scaffold proteins may confer specificity to innate immune responses downstream of TLRs
16956908 Observational study of gene-disease association. (HuGE Navigator)
16469733 Brx modifies the actions of glucocorticoids, enhancing the transcriptional activity of glucocorticoid receptor (GR) by interacting with GR and by attracting Rho family G proteins to the GR-induced transcriptisome
16412732 The spatiotemporal expression of Brx was altered in eutopic endometrium of women with endometriosis.
16301118 Yeast 2-Hybrid experiments identified a strong and novel interaction between the transglutaminase moiety and protein kinase A anchor protein 13 (AKAP13)
16234258 Observational study of gene-disease association. (HuGE Navigator)
16234258 significant association seen between rare AKAP13 Lys526Glyn variant and increased risk of development breast cancer; this variant might affect susceptibility to other cancers and might influence response to anticancer drugs targeting rho proteins
15691829 Rho-GEF activity of AKAP-Lbc is mediated by leucine zipper-mediated homo-oligomerization regulates
15229649 Anchoring of both PKA and 14-3-3 inhibits the Rho-GEF activity of the AKAP-Lbc signaling complex.
14660653 results indicate that guanine nucleotide exchange factor Lbc is a novel signal transducer for RhoA-mediated NF-kappaB activation in human peripheral blood monocytes stimulated with bacterial products
14636890 Proto-Lbc mutant expression led to decreased levels of Galpha12-induced RhoA activation in vivo.
12663445 The HA-3 peptide, VTEPGTAQY, is encoded by the lymphoid blast crisis oncogene, showing for the 1st time that a leukemia-associated oncogene can give rise to immunogenic T-cell epitopes that may participate in antihost & antileukemic alloimmune responses.
12270917 Results show that alpha-catulin co-expression leads to increased Lbc-induced serum response factor activation and may modulate Rho pathway signaling in vivo by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor.

AA Sequence

MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKV      1 - 70
QLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDQSGPPSGDVNSLDKKLVLAF     71 - 140
RHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLTWFLLQKPGGRGALSIHNQEGATPVSLALER    141 - 210
GYHKLHQLLTEENAGEPDSWSSLSYEIPYGDCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLM    211 - 280
NIQQQLMKTNLKQMDSLMPLMMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQT    281 - 350
ESPCDLSSIVEEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN    351 - 420
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAGEMEHGLMNPD    421 - 490
ATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAASSLDGNKPAESSLAFSNEET    491 - 560
STEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDGLEPYTLLAAGIGEAMSPSDLALLGLEEDVM    561 - 630
PHQNSETNSSHAQSQKGKSSPICSTTGDDKLCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSS    631 - 700
QDPPDASHCEDPQAHTVTSDPVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKME    701 - 770
KELVPDQAVISDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL    771 - 840
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKATLALDSVLTE    841 - 910
EGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDTQQFHEKSISADCAKDKALQL    911 - 980
SNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPPGASLATESRQEALGAEHNSSALLPCLLPDG    981 - 1050
SDGSDALNCSQPSPLDVGVKNTQSQGKTSACEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNV   1051 - 1120
LLSQEKNAVLGLPVALQDKAVTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQP   1121 - 1190
VAKELPTDMELSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI   1191 - 1260
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATGSLAGCFAGRE   1261 - 1330
EPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMKQGPMTQAINRENWCTIEPCP   1331 - 1400
DAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSDSDLFHSPSDDMDSIIFPKPEEEHLACDITG   1401 - 1470
SSSSTDDTASLDRHSSHGSDVSLSQILKPNRSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDS   1471 - 1540
ITEVPANCSVLRSSMRSLSPFRRHSWGPGKNAASDAEMNHRSSMRVLGDVVRRPPIHRRSFSLEGLTGGA   1541 - 1610
GVGNKPSSSLEVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNYCTSA   1611 - 1680
ISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWKSGTKVSRTFS   1681 - 1750
YIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVVGPISCSQCMKPFTNKDAYTC   1751 - 1820
ANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPTVIMRNKPSQPKERPRSAVLLVDETATTPIF   1821 - 1890
ANRRSQQSVSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQL   1891 - 1960
LGDFEIESKQLEAESWSRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLF   1961 - 2030
EQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKF   2031 - 2100
CGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVE   2101 - 2170
QEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFL   2171 - 2240
KNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEM   2241 - 2310
VEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKE   2311 - 2380
MIFRDMAECSTPLPEDCSPTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSP   2381 - 2450
IEQDVVGPVSLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQ   2451 - 2520
VVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEKQRQDLANLQKQ   2521 - 2590
QAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKEREELQQKKGTYQYDLERLRAAQKQ   2591 - 2660
LEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSFFPSPEEPPSPSAPSIAKSGSLDSELSVSPK   2661 - 2730
RNSISRTHKDKGPFHILSSTSQTNKGPEGQSQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGP   2731 - 2800
ASEVSAEGEEIFC                                                            2801 - 2813
//

Text Mined References (78)

PMID Year Title
26617690 2015 Up-regulation of AKAP13 and MAGT1 on cytoplasmic membrane in progressive hepatocellular carcinoma: a novel target for prognosis.
26272591 2015 Protein Kinase A-induced tamoxifen resistance is mediated by anchoring protein AKAP13.
25186459 2014 The crystal structure of the RhoA-AKAP-Lbc DH-PH domain complex.
24993829 2014 Structural insights into the activation of the RhoA GTPase by the lymphoid blast crisis (Lbc) oncoprotein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23716597 2013 A-kinase anchoring protein Lbc coordinates a p38 activating signaling complex controlling compensatory cardiac hypertrophy.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23535375 2013 Interleukin-27 treated human macrophages induce the expression of novel microRNAs which may mediate anti-viral properties.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23090968 2013 A-kinase-anchoring protein-Lbc anchors I?B kinase ? to support interleukin-6-mediated cardiomyocyte hypertrophy.
23045525 2012 Src homology 2 domain-containing phosphatase 2 (Shp2) is a component of the A-kinase-anchoring protein (AKAP)-Lbc complex and is inhibited by protein kinase A (PKA) under pathological hypertrophic conditions in the heart.
22731613 2012 The A-kinase-anchoring protein AKAP-Lbc facilitates cardioprotective PKA phosphorylation of Hsp20 on Ser(16).
22161024 2012 Amplification of thymosin beta 10 and AKAP13 genes in metastatic and aggressive papillary thyroid carcinomas.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21228793 2011 A regulatory SNP in AKAP13 is associated with blood pressure in Koreans.
21224381 2011 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in ?1-adrenergic receptor-induced p38 activation.
21102438 2010 AKAP-Lbc enhances cyclic AMP control of the ERK1/2 cascade.
20719862 2010 New loci associated with central cornea thickness include COL5A1, AKAP13 and AVGR8.
20696764 2010 The Lbc Rho guanine nucleotide exchange factor ?-catulin axis functions in serotonin-induced vascular smooth muscle cell mitogenesis and RhoA/ROCK activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353833 2010 Degree of predicted minor histocompatibility antigen mismatch correlates with poorer clinical outcomes in nonmyeloablative allogeneic hematopoietic cell transplantation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19960345 2010 Phase II trial and prediction of response of single agent tipifarnib in patients with relapsed/refractory mantle cell lymphoma: a Groupe d'Etude des Lymphomes de l'Adulte trial.
19946888 2010 Defining the membrane proteome of NK cells.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19888694 2009 Resonance assignments of the human AKAP13-PH domain and stabilizing DH helix.
19779964 2010 The mRNA and protein expression of A-kinase anchor proteins 13 in human colorectal cancer.
19696020 2009 The ubiquitin-like protein LC3 regulates the Rho-GEF activity of AKAP-Lbc.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18445682 2008 BNIP2 extra long inhibits RhoA and cellular transformation by Lbc RhoGEF via its BCH domain.
18093280 2008 Role of minor histocompatibility antigens in renal transplantation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17878165 2007 AKAP13, a RhoA GTPase-specific guanine exchange factor, is a novel regulator of TLR2 signaling.
17537920 2007 The A-kinase anchoring protein (AKAP)-Lbc-signaling complex mediates alpha1 adrenergic receptor-induced cardiomyocyte hypertrophy.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16956908 2007 The functional genetic variant Ile646Val located in the kinase binding domain of the A-kinase anchoring protein 10 is associated with familial breast cancer.
16469733 2006 Rho family Guanine nucleotide exchange factor Brx couples extracellular signals to the glucocorticoid signaling system.
16412732 2006 Expression of the proto-oncoprotein breast cancer nuclear receptor auxiliary factor (Brx) is altered in eutopic endometrium of women with endometriosis.
16301118 Tissue transglutaminase interacts with protein kinase A anchor protein 13 in prostate cancer.
16234258 2006 Association of genetic variants in the Rho guanine nucleotide exchange factor AKAP13 with familial breast cancer.
15691829 2005 Leucine zipper-mediated homo-oligomerization regulates the Rho-GEF activity of AKAP-Lbc.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15249197 2004 Lbc proto-oncogene product binds to and could be negatively regulated by metastasis suppressor nm23-H2.
15229649 2004 Anchoring of both PKA and 14-3-3 inhibits the Rho-GEF activity of the AKAP-Lbc signaling complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660653 2004 A Rho exchange factor mediates fMet-Leu-Phe-induced NF-kappaB activation in human peripheral blood monocytes.
14636890 2004 Role of Lbc RhoGEF in Galpha12/13-induced signals to Rho GTPase.
12972258 2003 Muscle-type creatine kinase interacts with central domains of the M-band proteins myomesin and M-protein.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12672969 2003 Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein kinase A anchoring.
12663445 2003 The minor histocompatibility antigen HA-3 arises from differential proteasome-mediated cleavage of the lymphoid blast crisis (Lbc) oncoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12423633 2002 Characterization of the interactions between the small GTPase RhoA and its guanine nucleotide exchange factors.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12270917 2002 Association of Lbc Rho guanine nucleotide exchange factor with alpha-catenin-related protein, alpha-catulin/CTNNAL1, supports serum response factor activation.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11696353 2001 Ht31: the first protein kinase A anchoring protein to integrate protein kinase A and Rho signaling.
11579095 2001 The proto-oncoprotein Brx activates estrogen receptor beta by a p38 mitogen-activated protein kinase pathway.
11546812 2001 AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho-mediated stress fiber formation.
11285229 2001 A novel mechanism of PKA anchoring revealed by solution structures of anchoring complexes.
11278452 2001 Physical and functional interactions of Galphaq with Rho and its exchange factors.
9891067 1999 Activation of the Lbc Rho exchange factor proto-oncogene by truncation of an extended C terminus that regulates transformation and targeting.
9627117 1998 Characterization of Brx, a novel Dbl family member that modulates estrogen receptor action.
8290273 1994 Novel human oncogene lbc detected by transfection with distinct homology regions to signal transduction products.
7929081 1994 Type II regulatory subunit (RII) of the cAMP-dependent protein kinase interaction with A-kinase anchor proteins requires isoleucines 3 and 5.
1860836 1991 Interaction of the regulatory subunit (RII) of cAMP-dependent protein kinase with RII-anchoring proteins occurs through an amphipathic helix binding motif.
1618839 1992 Association of the type II cAMP-dependent protein kinase with a human thyroid RII-anchoring protein. Cloning and characterization of the RII-binding domain.