Property Summary

NCBI Gene PubMed Count 69
PubMed Score 119.11
PubTator Score 67.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (34)

Disease log2 FC p
astrocytic glioma -2.900 1.3e-02
ependymoma -3.400 1.7e-02
oligodendroglioma -2.800 3.0e-02
psoriasis -1.600 3.5e-08
chronic lymphosyte leukemia 1.200 2.9e-05
group 4 medulloblastoma -2.400 1.4e-05
atypical teratoid / rhabdoid tumor -1.700 5.4e-03
medulloblastoma, large-cell -2.400 1.2e-03
Duchenne muscular dystrophy 1.103 9.7e-06
autosomal dominant Emery-Dreifuss muscul... 1.167 8.9e-03
Atopic dermatitis -1.800 9.3e-04
adrenocortical carcinoma -1.404 3.0e-02
primary pancreatic ductal adenocarcinoma 2.429 8.5e-04
tuberculosis -3.900 1.1e-07
non-small cell lung cancer -2.109 5.3e-16
intraductal papillary-mucinous adenoma (... -3.200 2.5e-04
intraductal papillary-mucinous carcinoma... -3.300 1.1e-03
intraductal papillary-mucinous neoplasm ... -2.100 3.4e-02
lung cancer -3.400 8.5e-06
colon cancer -2.500 1.1e-02
breast carcinoma -2.300 2.0e-06
fibroadenoma -1.800 7.9e-03
interstitial cystitis -1.300 1.3e-02
cystic fibrosis 1.200 6.4e-03
lung adenocarcinoma -1.592 2.1e-04
invasive ductal carcinoma -3.800 2.4e-04
lung carcinoma -1.100 3.1e-05
gastric carcinoma 1.700 2.8e-02
ductal carcinoma in situ -2.500 9.1e-04
ulcerative colitis 1.100 1.1e-02
ovarian cancer -2.500 2.0e-05
Gaucher disease type 3 -1.100 7.8e-03
pituitary cancer -1.700 1.3e-02
pancreatic cancer 2.400 6.5e-04

Gene RIF (50)

PMID Text
26646106 MiR-103 regulates hepatocellular carcinoma growth by targeting AKAP12
26645718 results suggest that the association between the 6q25.1 locus and breast cancer risk may be mediated through single nucleotide polymorphisms that regulate expressions of the AKAP12 gene.
26428665 The SSeCKS, a major Lipopolysaccharide (LPS) response protein, has been involved in regulating astrocyte activation via production of proinflammatory factor in CNS inflammation.
26406118 The authors propose that Gravin-mediated recruitment of Aurora A and Plk1 to the mother (oldest) spindle pole contributes to the fidelity of symmetric cell division.
25792458 AKAP12 variant 2 hypoxic induction shifts PKA-mediated protein phosphorylation to enhance migration and metastasis of melanoma cells
25748058 Elevated expression of AKAP12 is characteristic of paclitaxel-resistant high-grade serous ovarian cancer cells, and a prognostic and predictive marker for poor overall survival in SOC patients.
25637608 Cigarette smoke-induced changes in AKAP5 and AKAP12 in patients with COPD may affect efficacy of pharmacotherapy.
25356636 The enrichment of activated Cdc42 in SSeCKS-null leading edge filopodia correlated with recruitment of the Cdc42-specific guanine nucleotide exchange factor, Frabin.
25229625 AKAP12 scaffolding protein mediates meningeal reconstruction after central nervous system injury
25188285 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
24986638 This study showed that AKAP12,CAMK2D and a molecular pathway(cyclic amp)association to outcome of depressive during citalopram treatment.
24870731 AKAP12 expression was positive in 82.2% of tumors in a cohort with colorectal adenocarcinoma. AKAP12 expression was unrelated to p53 or Bcl-2 expression.
24065476 High AKAP12 expression is associated with colorectal cancer.
24042196 AKAP12 is differentially expressed in human astrocytomas showing high expression in pilocytic but low expression in diffuse astrocytomas of all WHO-grades. further, epigenetic mechanisms are involved in silencing AKAP12 in diffuse astrocytomas
23838009 Receptor-mediated Ca2+ and PKC signaling triggers the loss of cortical PKA compartmentalization through the redistribution of gravin.
23543478 Gravin gene expression is decreased in acute myeloid leukemia and correlates with poor prognosis.
23063527 It defines a role for Gravin as a temporal organizer of phosphorylation-dependent protein-protein interactions during mitosis.
22710722 Data suggest a model in which SSeCKS suppresses oncogenic motility by sequestering Src to caveolin-rich lipid rafts, thereby disengaging Src from FAK-associated adhesion and signaling complexes.
22584896 demonstrated for the first time that AKAP12 tumor/angiogenesis suppressor gene is an epigenetic target of HDAC7
21918680 The results demonstrate that AKAP12 may play an important role in tumor growth suppression and the survival of human colorectal cancer.
21903576 PKC-mediated remodeling of the actin cytoskeleton is likely regulated by the ability of SSeCKS to control PKC signaling and activity through a direct scaffolding function
21461577 AKAP12 is involved in the regulation of endothelial cell migration through the inhibitory regulation of MMP-9 expression in tumor cells.
21310466 AKAP12 promoter methylation is a frequent event in human prostate cancer.
21115911 AKAP12alpha promoter methylation is associated with lung cancer.
20979053 In addition to genetic alterations, epigenetic mechanisms are responsible for the reduction of the tumor suppressor gene AKAP12 in human hepatocarcinogenesis.
20939879 SERPINB5 and AKAP12 may have a role in increased metastasis in pancreatic ductal adenocarcinoma
20364105 Data show that AKAP12 methylation represents a potential molecular biomarker for predicting the malignancy of colorectal cancer.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20018890 Findings suggest that SSeCKS suppresses metastatic motility by disengaging activated Src and then inhibiting the PKC-Raf/MEK/ERK pathways controlling matrix metalloproteinase-2 expression and podosome formation.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Data revealed that six polymorphisms of F10, PITRM1, PCSK2, JPH3, MYO7B, and AKAP12 were related (P<0.05) to the prevalence of chronic kidney disease.
19724895 Observational study of gene-disease association. (HuGE Navigator)
19210988 Data show that PKC activation resulted in redistribution of gravin and PKA constructs to the same subcellular site, and suggest that this response to PKC activity may mediate PKC dependent control of PKA activity.
18950703 AKAP12 docks to the beta2-adrenergic receptor in response to agonist stimulation, later internalizes with agonist-induced receptors, and finally dissociates from the recycled, cell membrane-bound receptor.
18579430 Results suggest that AKAP12A may activate SREBP-2 by increasing cholesterol efflux, and is a novel regulator of cellular cholesterol metabolism.
18554502 These findings implicate AKAP12 in the regulation of cytokinesis progression, and suggest a novel role for AKAP12 tumor suppressor.
18397319 AKAP12 in astrocytes induces barrier functions in human endothelial cells through protein kinase Czeta.
18199717 Hypermethylation of the AKAP12 promoter is associated esophageal carcinoma.
17577780 The Gravin expression was found to be decreased in samples of acute leukaemia and was associated with an inferior overall survival.
17442832 AKAP12 may induce BRB formation through antiangiogenesis and barriergenesis in developing human eye and defects in this mechanism can lead to loss of tight junction proteins and contribute to development of retinal pathologies such as retinoblastoma.
17442483 Results suggest that AKAP12 may play an important role in tumor growth suppression by inducing apoptosis with the regulation of multiple molecules in the cell cycle progression.
17200117 The Src-binding peptide-(1-51) of gravin behaves as a dominant-negative for AKAP gravin regulation of beta2-adrenergic receptor resensitization/recycling
17081159 We conclude that LPA-dependent increased level of cAMP in senescent human diploid fibroblasts is associated with increases in Gravin levels resulting in its increased binding with and activation of calcium-dependent PKC alpha/beta and AC4/6.
16762919 Membrane binding of gravin, and thus function, can be reversed by calcium/calmodulin, which binds to the membrane and causes translocation of gravin from membrane to cytoplasm.
16642035 Results suggest that gravin maintains a signaling complex that includes protein kinase A and phosphodiesterase 4D.
15923193 AKAP12 localization is regulated by a hierarchy of targeting domains and the localization of AKAP12-assembled signaling complexes may be dynamically regulated
15590635 AKAP12alpha belongs to a novel class of atypical SRF-dependent target genes
15258566 AKAP12A may function as an important negative regulator of the survival pathway in human gastric cancer.
14657015 AKAP250 acts as a scaffold that binds protein kinase A (PKA), protein kinase C and protein phosphatases, associating reversibly with the beta(2)-adrenergic receptor.
12857743 gravin provides a dynamic platform for the localization for kinases during neuronal development

AA Sequence

MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNGQLSTINGVAE      1 - 70
QDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDSDKEMATKSAVVHDITDDGQE     71 - 140
ETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVGFKFTVKKDKTEKPDTVQLLTVKKDEGEGAA    141 - 210
GAGDHKDPSLGAGEAASKESEPKQSTEKPEETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKS    211 - 280
AESPTSPVTSETGSTFKKFFTQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKL    281 - 350
TASEQAHPQEPAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH    351 - 420
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLS    421 - 490
KPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVPADSPDSQEE    491 - 560
QKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDGEKKREGVTPWASFKKMVTPKKRVRRPSESD    561 - 630
KEDELDKVKSATLSSTESTASEMQEEMKGSVEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDE    631 - 700
EGGPKAMGGDHQKADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRK    701 - 770
KSKSKLEEKSEDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD    771 - 840
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGTRAATIIEERS    841 - 910
PSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREARGDTVVSEAELTPEAVTAAE    911 - 980
TAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEATPVQEVEGGVPDIEEQERRTQEVLQAVAEKV    981 - 1050
KEESQLPGTGGPEDVLQPVQRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESF   1051 - 1120
EKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDE   1121 - 1190
IVEIHEENEVASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK   1191 - 1260
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDALELQSHAKSPP   1261 - 1330
SPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNVPIIDGAKEVSSLEGSPPPCL   1331 - 1400
GQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILETGETLEPAGAHLVLEEKSSEKNEDFAAHPGE   1401 - 1470
DAVPTGPDCQAKSTPVIVSATTKKGLSSDLEGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGIL   1471 - 1540
ELETKSSKLVQNIIQTAVDQFVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETP   1541 - 1610
ITSAKEESESTAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG   1611 - 1680
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKEDAQEVELQEGK   1681 - 1750
VHSESDKAITPQAQEELQKQERESAKSELTES                                         1751 - 1782
//

Text Mined References (84)

PMID Year Title
26646106 2016 MiR-103 regulates hepatocellular carcinoma growth by targeting AKAP12.
26645718 2016 Evaluation of potential regulatory function of breast cancer risk locus at 6q25.1.
26428665 2015 HSPA12B regulates SSeCKS-mediated astrocyte inflammatory activation in neuroinflammation.
26406118 2015 A mitotic kinase scaffold depleted in testicular seminomas impacts spindle orientation in germ line stem cells.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25792458 2015 Hypoxic induction of AKAP12 variant 2 shifts PKA-mediated protein phosphorylation to enhance migration and metastasis of melanoma cells.
25748058 2015 Elevated AKAP12 in paclitaxel-resistant serous ovarian cancer cells is prognostic and predictive of poor survival in patients.
25637608 2015 A-kinase-anchoring proteins coordinate inflammatory responses to cigarette smoke in airway smooth muscle.
25356636 2014 Suppression of chemotaxis by SSeCKS via scaffolding of phosphoinositol phosphates and the recruitment of the Cdc42 GEF, Frabin, to the leading edge.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25229625 2014 Prompt meningeal reconstruction mediated by oxygen-sensitive AKAP12 scaffolding protein after central nervous system injury.
25188285 2014 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24986638 2015 A molecular pathway analysis of the glutamatergic-monoaminergic interplay serves to investigate the number of depressive records during citalopram treatment.
24870731 2014 Lack of relation of AKAP12 with p53 and Bcl-2 in colorectal carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24065476 AKAP12/Gravin gene expression in colorectal cancer: clinical importance and review of the literature.
24042196 2013 Differential expression of the tumor suppressor A-kinase anchor protein 12 in human diffuse and pilocytic astrocytomas is regulated by promoter methylation.
23838009 2013 Receptor-mediated Ca2+ and PKC signaling triggers the loss of cortical PKA compartmentalization through the redistribution of gravin.
23543478 2013 Gravin gene expression in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063527 2012 Gravin is a transitory effector of polo-like kinase 1 during cell division.
22710722 2013 Adhesion-mediated cytoskeletal remodeling is controlled by the direct scaffolding of Src from FAK complexes to lipid rafts by SSeCKS/AKAP12.
22584896 2012 The angiogenesis suppressor gene AKAP12 is under the epigenetic control of HDAC7 in endothelial cells.
21918680 2011 Re-expression of AKAP12 inhibits progression and metastasis potential of colorectal carcinoma in vivo and in vitro.
21903576 2011 Control of protein kinase C activity, phorbol ester-induced cytoskeletal remodeling, and cell survival signals by the scaffolding protein SSeCKS/GRAVIN/AKAP12.
21540461 2011 A genome-wide association study identifies novel loci associated with susceptibility to chronic myeloid leukemia.
21461577 Inhibition of endothelial cell migration through the down?regulation of MMP-9 by A-kinase anchoring protein 12.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310466 2011 Quantitative assessment of AKAP12 promoter methylation in human prostate cancer using methylation-sensitive high-resolution melting: correlation with Gleason score.
21269460 2011 Initial characterization of the human central proteome.
21115911 2010 Methylation of AKAP12{alpha} promoter in lung cancer.
20979053 2010 Down-regulation of tumor suppressor A kinase anchor protein 12 in human hepatocarcinogenesis by epigenetic mechanisms.
20939879 2010 SERPINB5 and AKAP12 - expression and promoter methylation of metastasis suppressor genes in pancreatic ductal adenocarcinoma.
20364105 2010 Quantitative assessment of AKAP12 promoter methylation in colorectal cancer using methylation-sensitive high resolution melting: Correlation with Duke's stage.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
20018890 2010 SSeCKS/Gravin/AKAP12 inhibits cancer cell invasiveness and chemotaxis by suppressing a protein kinase C- Raf/MEK/ERK pathway.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19210988 2009 Gravin dynamics regulates the subcellular distribution of PKA.
18950703 2009 G-protein-coupled receptor-associated A-kinase anchoring proteins AKAP5 and AKAP12: differential trafficking and distribution.
18579430 2008 Overexpression of A-kinase anchoring protein 12A activates sterol regulatory element binding protein-2 and enhances cholesterol efflux in hepatic cells.
18554502 2008 A-kinase anchoring protein 12 regulates the completion of cytokinesis.
18397319 2008 AKAP12 in astrocytes induces barrier functions in human endothelial cells through protein kinase Czeta.
18199717 2008 Hypermethylation of the AKAP12 promoter is a biomarker of Barrett's-associated esophageal neoplastic progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17577780 2007 Gravin gene expression in acute leukaemias: clinical importance and review of the literature.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17442832 2007 AKAP12 regulates human blood-retinal barrier formation by downregulation of hypoxia-inducible factor-1alpha.
17442483 2007 AKAP12 induces apoptotic cell death in human fibrosarcoma cells by regulating CDKI-cyclin D1 and caspase-3 activity.
17200117 2007 Src docks to A-kinase anchoring protein gravin, regulating beta2-adrenergic receptor resensitization and recycling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081159 2006 Role of protein kinase C-dependent A-kinase anchoring proteins in lysophosphatidic acid-induced cAMP signaling in human diploid fibroblasts.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16762919 2006 Regulation of AKAP-membrane interactions by calcium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15923193 2005 Cross-species sequence analysis reveals multiple charged residue-rich domains that regulate nuclear/cytoplasmic partitioning and membrane localization of a kinase anchoring protein 12 (SSeCKS/Gravin).
15590635 2005 AKAP12alpha, an atypical serum response factor-dependent target gene.
15496411 2004 Multiple promoters direct expression of three AKAP12 isoforms with distinct subcellular and tissue distribution profiles.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15258566 2004 AKAP12/Gravin is inactivated by epigenetic mechanism in human gastric carcinoma and shows growth suppressor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657015 2003 Protein kinase A regulates AKAP250 (gravin) scaffold binding to the beta2-adrenergic receptor.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12857743 2003 Differential and regulated binding of cAMP-dependent protein kinase and protein kinase C isoenzymes to gravin in human model neurons: Evidence that gravin provides a dynamic platform for the localization for kinases during neuronal development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11807172 2002 AKAP mediated signal transduction.
11766078 2001 Autoantibody to gravin is expressed more strongly in younger and nonthymomatous patients with myasthenia gravis.
11316952 Intracellular distribution of gravin, a PKA and PKC binding protein, in vascular endothelial cells.
11309381 2001 The scaffold protein gravin (cAMP-dependent protein kinase-anchoring protein 250) binds the beta 2-adrenergic receptor via the receptor cytoplasmic Arg-329 to Leu-413 domain and provides a mobile scaffold during desensitization.
10858453 2000 Gravin-mediated formation of signaling complexes in beta 2-adrenergic receptor desensitization and resensitization.
9880537 1999 Dynamic complexes of beta2-adrenergic receptors with protein kinases and phosphatases and the role of gravin.
9604001 1998 Changes of gene expression by lysophosphatidylcholine in vascular endothelial cells: 12 up-regulated distinct genes including 5 cell growth-related, 3 thrombosis-related, and 4 others.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.
9000000 1997 Gravin, an autoantigen recognized by serum from myasthenia gravis patients, is a kinase scaffold protein.
1522245 1992 Molecular cloning and preliminary characterization of a novel cytoplasmic antigen recognized by myasthenia gravis sera.