Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.67
PubTator Score 11.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -3.100 6.7e-07
glioblastoma -1.900 2.8e-03
osteosarcoma 1.161 9.9e-04
astrocytoma -1.300 8.5e-03
atypical teratoid / rhabdoid tumor -2.000 1.7e-07
medulloblastoma -1.300 2.6e-07
medulloblastoma, large-cell -1.900 3.9e-05
primitive neuroectodermal tumor -1.200 4.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.208 7.6e-03
hereditary spastic paraplegia -1.078 1.8e-02
Amyotrophic Lateral Sclerosis 1.277 2.2e-05
lung cancer -1.600 7.6e-05
Parkinson's disease -1.300 2.8e-02
diabetes mellitus -1.300 2.1e-03
pediatric high grade glioma -1.500 3.3e-06
ovarian cancer -2.600 1.0e-07

Synonym

Accession Q9UKA4 O75124 Q9NUK7 AKAP-11
Symbols PRKA11
AKAP-11
AKAP220
PPP1R44

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Gene RIF (4)

PMID Text
26088133 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3beta to A-kinase Anchoring Protein 220.
25188285 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
21890631 AKAP220 protein organizes signaling elements that impact cell migration.
12147701 binds to glycogen synthase kinase-3beta (GSK-3beta) and mediates protein kinase A-dependent inhibition of GSK-3beta

AA Sequence

MATFRNNHMKTKASVRKSFSEDVFQSVKSLLQSQKELCSVTAEDCLQQDEHANLTEVTFLGFNEETDAAH      1 - 70
IQDLAAVSLELPDILNSLHFCSLNENEIICMKNINKPLDISSDPLNQSHPSGMLCVMRVSPTSPRLRIDF     71 - 140
IFSLLSKYATGIRYTLDTFLHQKHQLETTDEDDDDTNQSVSSIEDDFVTAFEHLEEEETSKPYNDGMNIT    141 - 210
VLRSQCDAASQTVTGHHLETHDLKILISSGQQKSLAKPSTSSVNVLGHKELPSVKTSVTTSISEPWTQRS    211 - 280
FYRSSNASDKDSDLQKTFFSSSPAYSSESECSSPSPVIFLDEEGYQKSLKAKLELPKIPVMKDDIEDSDS    281 - 350
EVSEFFDSFDQFDELEQTLETCLFNKDPVIGKSSQRKGHKHGKSCMNPQKFKFDRPALPANVRKPTPRKP    351 - 420
ESPYGNLCDAPDSPRPVKASREDSGLFSPIRSSAFSPLGGCTPAECFCQTDIGGDRIHENHDSVYYTYED    421 - 490
YAKSISCEVLGSVLRTHHTNTLSNINSIKHGENKTVTFKHGNLDQKNKSKNKSLMIKDSIQKFAADLVEK    491 - 560
SFGSAFKDLQKGVSSCTNALYHLAIKLTSSVLQMAFDELRRQRAFSLKERAISGLANFLVSEALSNALKD    561 - 630
LQYVKKQIFTNTVARFAADLAEELVFEGIMEVCQFSYPQTPASPQCGSFDFEDKVVKLYAKDLSESVIQE    631 - 700
AFIELSQVDVTFTTKAAVSVSTDNIKYVSAESVVPSTQAVTFSPSFHNQAIMVTKPVQEYKKEYTVQQAL    701 - 770
FCTSGIVTSIPVPLAGSALLPYHISSTACQAKAHLSSDDSNSNGDSAQVHIATKNREEKAACLRNICLPS    771 - 840
EHNPGNQNDFKPTNDDIEMQSSSKLPNDPAIISNFSAAVVHTIVNETLESMTSLEVTKMVDERTDYLTKS    841 - 910
LKEKTPPFSHCDQAVLQCSEASSNKDMFADRLSKSIIKHSIDKSKSVIPNIDKNAVYKESLPVSGEESQL    911 - 980
TPEKSPKFPDSQNQLTHCSLSAAKDCVPECKVSMVHGSSLETLPSCPAVTGQKSDLKESAKDQPLKKHNL    981 - 1050
NSTSLEALSFGQENPFPHSHTFSSTALTCVDGLHVEDKQKVRDRNVIPDTPPSTPLVPSRASSEWDIKKL   1051 - 1120
TKKLKGELAKEFAPATPPSTPHNSSVGSLSENEQNTIEKEEFMLKLMRSLSEEVESSESGELPEVDVKSE   1121 - 1190
HSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFA   1191 - 1260
GDLAAEVITEAEKIAKVRNCMLFKQKKNSCYADGDEDYKVEEKLDIEAVVHPREVDPFILSLPPSSCMSG   1261 - 1330
LMYKYPSCESVTDEYAGHLIQILKQEGGNSELIMDQYANRLAYRSVKSGLQEAAKTTKVQCNSRMFPVPS   1331 - 1400
SQVKTNKELLMFSNKEHHQEADKKRQSKRNEGYFCKNQTCERTLDPYRNEVSQLYSFSTSLVHSITKDAK   1401 - 1470
EELTASLVGLPKSLTDSCLFEKSGYEEDNECHVTPELPKSLQPSSQNHRFYHSTGSLNGYGCGDNVVQAV   1471 - 1540
EQYAKKVVDDTLELTLGSTVFRVSETTKSADRVTYAEKLSPLTGQACRYCDLKELHNCTGNSSQHFFRQG   1541 - 1610
SLASSKPASNPKFSSRYQKSRIFHLSVPQIHVNLDKKAVLAEKIVAEAIEKAERELSSTSLAADSGIGQE   1611 - 1680
GASFAESLATETMTAAVTNVGHAVSSSKEIEDFQSTESVSSQQMNLSIGDDSTGSWSNLSFEDEHQDESS   1681 - 1750
SFHHLSESNGNSSSWSSLGLEGDLYEDNLSFPTSDSDGPDDKDEEHEDEVEGLGQDGKTLLITNIDMEPC   1751 - 1820
TVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERC   1821 - 1890
KSLFDWLLENA                                                              1891 - 1901
//

Text Mined References (30)

PMID Year Title
26088133 2015 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3? to A-kinase Anchoring Protein 220.
25188285 2014 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21890631 2011 AKAP220 protein organizes signaling elements that impact cell migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12147701 2002 A-kinase anchoring protein AKAP220 binds to glycogen synthase kinase-3beta (GSK-3beta ) and mediates protein kinase A-dependent inhibition of GSK-3beta.
11823486 2002 Identification and characterization of myeloid translocation gene 16b as a novel a kinase anchoring protein in T lymphocytes.
11807172 2002 AKAP mediated signal transduction.
11152471 2001 Multiple interactions within the AKAP220 signaling complex contribute to protein phosphatase 1 regulation.
10864471 2000 Localization of a novel human A-kinase-anchoring protein, hAKAP220, during spermatogenesis.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10209101 1999 Association of the type 1 protein phosphatase PP1 with the A-kinase anchoring protein AKAP220.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.
8621616 1996 Cloning and characterization of a novel A-kinase anchoring protein. AKAP 220, association with testicular peroxisomes.