Property Summary

NCBI Gene PubMed Count 11
PubMed Score 26.48
PubTator Score 12.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Endometriosis -1.286 1.6e-02
ependymoma 3.000 1.1e-09
medulloblastoma, large-cell 1.200 4.2e-05
nasopharyngeal carcinoma -2.200 5.4e-10
osteosarcoma -1.495 6.4e-07
ovarian cancer 1.300 8.6e-09
psoriasis -1.200 1.7e-70

Gene RIF (4)

AA Sequence

MAEEEETAALTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENKSAMLEASSTK      1 - 70
VKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNITESSQQMEEAIWAVSALSEEV     71 - 140
SHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRRRKSHPNFLDHINAEKMVLKFGKKARKFAAY    141 - 210
VVAAGLQYGAEGGMLHTFFKMAWLGEIPALPVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDE    211 - 280
SVHTLEDIVKCISKNTGPGKIQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVE    281 - 350
NINTILKEYKQSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE    351 - 420
GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQA    421 - 490
KDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNY    491 - 560
RDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERL    561 - 630
AREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECC    631 - 700
NVRPEDPVDFLAEYLFKNNPEAQ                                                   701 - 723
//

Text Mined References (11)

PMID Year Title