Property Summary

NCBI Gene PubMed Count 17
PubMed Score 223.13
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.5e-05
progressive supranuclear palsy 676 5.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.887 1.9
Spinocerebellar ataxia type 7 13 3.69 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.200 4.5e-05
progressive supranuclear palsy -1.200 5.6e-03

Gene RIF (2)

AA Sequence

MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR      1 - 70
EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI     71 - 140
VHQLPSNKPEELENNVDQILKWIEQWIKDHNS                                          141 - 172
//

Text Mined References (17)

PMID Year Title