Property Summary

NCBI Gene PubMed Count 20
PubMed Score 64.89
PubTator Score 18.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis -1.455 1.0e-02
malignant mesothelioma -3.400 1.1e-08
astrocytic glioma -1.500 5.7e-03
ependymoma -2.000 3.7e-02
oligodendroglioma -1.500 2.0e-02
osteosarcoma 2.330 6.5e-04
group 4 medulloblastoma -2.800 2.0e-09
atypical teratoid/rhabdoid tumor -1.400 9.5e-04
glioblastoma -1.100 2.5e-02
medulloblastoma, large-cell -1.800 9.0e-03
primitive neuroectodermal tumor -1.800 1.1e-05
adrenocortical carcinoma 2.923 1.1e-03
primary pancreatic ductal adenocarcinoma 1.591 6.6e-03
tuberculosis -1.800 1.3e-04
non-small cell lung cancer 2.722 5.1e-22
intraductal papillary-mucinous adenoma (... 2.300 4.5e-03
Hydrolethalus syndrome 2.077 2.2e-02
lung cancer 2.500 2.1e-05
pancreatic cancer 2.100 1.3e-05
interstitial cystitis -1.100 8.5e-03
pilocytic astrocytoma -1.300 3.4e-04
subependymal giant cell astrocytoma 1.333 3.0e-02
invasive ductal carcinoma -2.200 4.5e-02
Pick disease 1.500 5.7e-05
Breast cancer -1.200 7.0e-05
ovarian cancer 2.400 1.6e-04

Gene RIF (6)

PMID Text
26980435 Results found that AK4 was involved in hypoxia tolerance, resistance to anti-tumor drug, and the regulation of mitochondrial activity.
23474458 a stress-protective function of AK4
23002211 Data indicate that patients with high adenylate kinase-4 (AK4) and low transcription factor ATF3 expression showed unfavorable outcomes compared with patients with low AK4 and high ATF3 expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19766732 The AK4 cDNA was expressed in Escherichia coli and the substrate specificity and kinetic properties of the recombinant protein were characterized.
19073142 To investigate the role of hinge IV, crystal structure of human adenylate kinase 4 (AK4) L171P mutant was determined.

AA Sequence

MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVIT      1 - 70
RLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDF     71 - 140
NPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLF    141 - 210
SNKITPIQSKEAY                                                             211 - 223
//

Text Mined References (25)

PMID Year Title
26980435 2016 Modulation of anti-cancer drug sensitivity through the regulation of mitochondrial activity by adenylate kinase 4.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23474458 2013 Differential expression of adenylate kinase 4 in the context of disparate stress response strategies of HEK293 and HepG2 cells.
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23002211 2012 Adenylate kinase-4 is a marker of poor clinical outcomes that promotes metastasis of lung cancer by downregulating the transcription factor ATF3.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19766732 2010 Evidence of an intact N-terminal translocation sequence of human mitochondrial adenylate kinase 4.
19073142 2009 Crystal structure of human adenylate kinase 4 (L171P) suggests the role of hinge region in protein domain motion.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11485571 2001 Structure and expression of human mitochondrial adenylate kinase targeted to the mitochondrial matrix.
10544043 1999 Cloning and functional characterization of the promoter region of the gene encoding human adenylate kinase isozyme 3.
9813319 1998 Identification of a novel adenylate kinase system in the brain: cloning of the fourth adenylate kinase.
9504419 1998 Mechanism of mitochondrial import of adenylate kinase isozymes.
7140357 1982 Report of the committee on the genetic constitution of chromosomes 7, 8, and 9. Oslo Conference (1981): Sixth International Workshop on Human Gene Mapping.
1639383 1992 Characterization of human adenylate kinase 3 (AK3) cDNA and mapping of the AK3 pseudogene to an intron of the NF1 gene.
182062 1976 Evidence for the assignment of the loci AK1, AK3 and ACONs to chromosome 9 in man.