Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.48
PubTator Score 79.99

Knowledge Summary

Patent (7,325)

Expression

  Differential Expression (6)

Disease log2 FC p
invasive ductal carcinoma -1.500 2.0e-04
osteosarcoma 1.490 7.2e-04
ovarian cancer -2.100 3.9e-06
pancreatic cancer 1.700 8.1e-04
pancreatic ductal adenocarcinoma liver m... -2.159 1.8e-04
ulcerative colitis -1.200 6.2e-09

Gene RIF (2)

AA Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV      1 - 70
MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI     71 - 140
EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA    141 - 210
FLQTKVPQRSQKASVTP                                                         211 - 227
//

Text Mined References (19)

PMID Year Title