Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.03
PubTator Score 79.99

Knowledge Summary

Patent (7,325)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.490 7.2e-04
pancreatic ductal adenocarcinoma liver m... -2.893 2.3e-03
invasive ductal carcinoma -1.500 2.0e-04
ulcerative colitis -1.200 6.2e-09
ovarian cancer -2.100 3.9e-06
pancreatic cancer 1.700 8.1e-04

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV      1 - 70
MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI     71 - 140
EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA    141 - 210
FLQTKVPQRSQKASVTP                                                         211 - 227
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11485571 2001 Structure and expression of human mitochondrial adenylate kinase targeted to the mitochondrial matrix.
10544043 1999 Cloning and functional characterization of the promoter region of the gene encoding human adenylate kinase isozyme 3.
218813 1979 Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.
182062 1976 Evidence for the assignment of the loci AK1, AK3 and ACONs to chromosome 9 in man.