Property Summary

NCBI Gene PubMed Count 22
PubMed Score 90.57
PubTator Score 52.25

Knowledge Summary

Patent (5,806)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.400 8.3e-04
psoriasis -1.300 1.1e-03
glioblastoma 1.700 2.9e-03
osteosarcoma 1.848 4.5e-04
posterior fossa group A ependymoma 1.300 5.1e-10
astrocytoma 1.500 8.5e-03
atypical teratoid / rhabdoid tumor 1.200 5.9e-08
medulloblastoma, large-cell 1.400 3.0e-05
pancreatic ductal adenocarcinoma liver m... -1.272 6.2e-03
lung cancer -1.500 9.9e-04
pediatric high grade glioma 1.200 4.4e-06
group 3 medulloblastoma 1.200 2.3e-03
pilocytic astrocytoma 1.600 3.9e-12
lung adenocarcinoma 1.200 1.0e-08
Breast cancer 1.100 1.7e-05

 OMIM Phenotype (1)

Gene RIF (9)

PMID Text
26270350 AK2 deficiency compromises the mitochondrial energy metabolism required for differentiation of human neutrophil and lymphoid lineages.
24587121 AK2 is indispensable for neutrophil differentiation, indicating a possible causative link between AK2 deficiency and neutropenia in reticular dysgenesis.
24548998 results suggest that AK2 is an associated activator of DUSP26 and suppresses cell proliferation by FADD dephosphorylation, postulating AK2 as a negative regulator of tumour growth.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of adenylate kinase 2 (AK2) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
19043417 The gene encoding the mitochondrial energy metabolism enzyme adenylate kinase 2 (AK2) is mutated in individuals with reticular dysgenesis.
19043416 Biallelic mutations in AK2 (adenylate kinase 2) in seven individuals affected with reticular dysgenesis and sensorineural deafness, were identified.
18404568 The alpha-borano or alpha-H on PMEA and PMPA were detrimental to the activity of recombinant human AMP kinases 2
17952061 These results suggest that, acting in concert with FADD and caspase-10, AK2 mediates a novel intrinsic apoptotic pathway that may be involved in tumorigenesis.

AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA      1 - 70
GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT     71 - 140
GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI    141 - 210
DASQTPDVVFASILAAFSKATCKDLVMFI                                             211 - 239
//

Text Mined References (29)

PMID Year Title
26270350 2015 AK2 deficiency compromises the mitochondrial energy metabolism required for differentiation of human neutrophil and lymphoid lineages.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24587121 2014 Differential expression of adenine nucleotide converting enzymes in mitochondrial intermembrane space: a potential role of adenylate kinase isozyme 2 in neutrophil differentiation.
24548998 2014 The DUSP26 phosphatase activator adenylate kinase 2 regulates FADD phosphorylation and cell growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19043417 2009 Reticular dysgenesis (aleukocytosis) is caused by mutations in the gene encoding mitochondrial adenylate kinase 2.
19043416 2009 Human adenylate kinase 2 deficiency causes a profound hematopoietic defect associated with sensorineural deafness.
18404568 2008 Acyclic phosphonate nucleotides and human adenylate kinases: impact of a borano group on alpha-P position.
17952061 2007 AK2 activates a novel apoptotic pathway through formation of a complex with FADD and caspase-10.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10218571 1999 Release of adenylate kinase 2 from the mitochondrial intermembrane space during apoptosis.
9504408 1998 Cloning and expression of human adenylate kinase 2 isozymes: differential expression of adenylate kinase 1 and 2 in human muscle tissues.
9434148 1998 cDNA cloning and tissue-specific expression of the gene encoding human adenylate kinase isozyme 2.
8843353 1996 Cloning and characterization of cDNA for human adenylate kinase 2A.
6961883 1982 Gene order and localization of enzyme loci on the short arm of chromosome 1.
6182143 1982 Adenosine triphosphate-adenosine-5'-monophosphate phosphotransferase from normal human liver mitochondria. Isolation, chemical properties, and immunochemical comparison with Duchenne dystrophic serum aberrant adenylate kinase.
195572 1977 Adenylate kinase 2, a mitochondrial enzyme.