Property Summary

NCBI Gene PubMed Count 23
PubMed Score 98.72
PubTator Score 52.25

Knowledge Summary

Patent (5,806)

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 1.0e-03
astrocytoma 1.500 8.5e-03
Astrocytoma, Pilocytic 1.300 1.4e-09
atypical teratoid / rhabdoid tumor 1.200 5.9e-08
Breast cancer 1.100 1.7e-05
ependymoma 1.200 5.2e-11
glioblastoma 1.700 2.9e-03
group 3 medulloblastoma 1.200 2.3e-03
lung adenocarcinoma 1.200 1.0e-08
lung cancer -1.500 9.9e-04
malignant mesothelioma 1.200 9.3e-06
medulloblastoma, large-cell 1.400 3.0e-05
osteosarcoma 1.848 4.5e-04
pancreatic ductal adenocarcinoma liver m... -1.135 8.8e-04
psoriasis -1.300 1.1e-03

 OMIM Phenotype (1)

Gene RIF (10)

AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA      1 - 70
GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT     71 - 140
GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI    141 - 210
DASQTPDVVFASILAAFSKATCKDLVMFI                                             211 - 239
//

Text Mined References (30)

PMID Year Title