Property Summary

NCBI Gene PubMed Count 35
PubMed Score 203.90
PubTator Score 186.92

Knowledge Summary

Patent (8,293)

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 7.5e-16

Protein-protein Interaction (2)

Gene RIF (15)

PMID Text
24495878 Studies indicate that the preferred substrate and phosphate donor of all adenylate kinases are AMP and ATP respectively.
23863634 Dysregulation of AMPK is both a pathogenic factor for these disorders in humans and a target for their prevention and therapy. [Review]
23146316 Ak(1)2-1 phenotype is more frequent in males conceived in the summer-autumn period than in those conceived in winter-spring, and this association depends on maternal Ak(1) phenotype.
22637533 identified hitherto unrecognized soluble forms of AK1 and NTPDase1/CD39 that contribute in the active cycling between the principal platelet-recruiting agent ADP and other circulating nucleotides
22419736 Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration.
22287021 Our findings suggest a reduced reproductive efficiency of women carrying the Ak(1)2-1 phenotype: this could have practical importance in predicting the probability of reproductive success in couples with RSA
21831515 AK1 phenotypic activity is associated with birth weight and placental weight; these associations are greater in infants born at gestational age greater than 38 weeks.
21457004 The adipokine zinc-alpha2-glycoprotein activates AMP kinase in human primary skeletal muscle cells.
20152999 the correlation between blood glucose and glycated Hb in relation to AK1 and ACP1 polymorphism was studied.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18850517 The data suggest that zygotes carrying AK1*2 allele are relatively protected from the damaging effects of smoking
18850517 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18404568 The alpha-borano or alpha-H on PMEA and PMPA were detrimental to the activity of recombinant human AMP kinases 1
16714292 analysis of vascular endothelial ectoadenylate kinase and plasma membrane ATP synthase
12649162 how mutations found in 2 patients may affect enzyme structure and function; a compound heterozygote for 2 different missense mutations 118G>A(Gly40Arg) and 190G>A(Gly64Arg); a homozygote for either aspartic acid (Asp) 140 or 141

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE      1 - 70
TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD     71 - 140
DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK                    141 - 194
//

Text Mined References (39)

PMID Year Title
24495878 2014 The many isoforms of human adenylate kinases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23863634 2013 AMPK, insulin resistance, and the metabolic syndrome.
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146316 2013 Ak(1) genetic polymorphism and season of conception.
22637533 2012 Metabolism of circulating ADP in the bloodstream is mediated via integrated actions of soluble adenylate kinase-1 and NTPDase1/CD39 activities.
22419736 2012 Neuropathogenic role of adenylate kinase-1 in A?-mediated tau phosphorylation via AMPK and GSK3?.
22287021 Adenylate kinase genetic polymorphism and spontaneous abortion.
21831515 2011 Adenylate kinase locus 1 polymorphism and feto-placental development.
21457004 2011 The adipokine zinc-?2-glycoprotein activates AMP kinase in human primary skeletal muscle cells.
21269460 2011 Initial characterization of the human central proteome.
20152999 2011 The effect of genetic variability on the correlation between blood glucose and glycated hemoglobin levels.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18850517 2009 Smoking and human reproduction: the effect of adenylate kinase genetic polymorphism.
18404568 2008 Acyclic phosphonate nucleotides and human adenylate kinases: impact of a borano group on alpha-P position.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16714292 2006 Ectoadenylate kinase and plasma membrane ATP synthase activities of human vascular endothelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12649162 2003 Red cell adenylate kinase deficiency: molecular study of 3 new mutations (118G>A, 190G>A, and GAC deletion) associated with hereditary nonspherocytic hemolytic anemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432079 2002 Subcellular targeting of metabolic enzymes to titin in heart muscle may be mediated by DRAL/FHL-2.
12124227 2002 Adenylate kinase AK1 knockout heart: energetics and functional performance under ischemia-reperfusion.
10557075 1999 wt p53 dependent expression of a membrane-associated isoform of adenylate kinase.
10233365 1999 A case of complete adenylate kinase deficiency due to a nonsense mutation in AK-1 gene (Arg 107 --> Stop, CGA --> TGA) associated with chronic haemolytic anaemia.
9504408 1998 Cloning and expression of human adenylate kinase 2 isozymes: differential expression of adenylate kinase 1 and 2 in human muscle tissues.
9432020 1997 Severe erythrocyte adenylate kinase deficiency due to homozygous A-->G substitution at codon 164 of human AK1 gene associated with chronic haemolytic anaemia.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7947281 1994 Congenital haemolytic anaemia associated with adenylate kinase deficiency.
6305188 1983 Red cell adenylate kinase deficiency associated with hereditary nonspherocytic hemolytic anemia: clinical and biochemical studies.
3024483 1986 Segregation of marker loci in families with an inherited paracentric insertion of chromosome 9.
2542324 1989 Human adenylate kinase deficiency associated with hemolytic anemia. A single base substitution affecting solubility and catalytic activity of the cytosolic adenylate kinase.
2541064 1989 Regional assignment of the loci for adenylate kinase to 9q32 and for alpha 1-acid glycoprotein to 9q31-q32. A locus for Goltz syndrome in region 9q32-qter?
211388 1978 AMP (dAMP) kinase from human erythrocytes.
183954 1976 Primary and tertiary structure of the principal human adenylate kinase.