Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.90
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.629 3.9e-02
adrenocortical carcinoma 1.183 4.5e-02
adult high grade glioma 1.200 6.6e-04
Astrocytoma, Pilocytic 1.300 3.3e-05
atypical teratoid / rhabdoid tumor 3.800 2.9e-12
Breast cancer 2.400 2.6e-02
ependymoma 1.400 4.4e-02
glioblastoma 2.000 9.0e-07
interstitial cystitis -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... -1.700 6.6e-03
medulloblastoma 1.200 1.7e-02
nasopharyngeal carcinoma 1.100 1.4e-03
osteosarcoma 1.465 3.7e-03
ovarian cancer -2.000 5.6e-06
Polycystic ovary syndrome -1.358 4.2e-03
primitive neuroectodermal tumor 2.200 4.1e-04
spina bifida -1.922 3.6e-02

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEPLEPAREQGSL      1 - 70
DAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSPRSSFASSSASDASKPSSPRG     71 - 140
SLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAA    141 - 210
LDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDEL    211 - 280
TALLRLTVGTGGREAGARGEPSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSN    281 - 350
ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK    351 - 420
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYH    421 - 490
FECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI                          491 - 538
//

Text Mined References (46)

PMID Year Title