Property Summary

NCBI Gene PubMed Count 21
PubMed Score 17.63
PubTator Score 22.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 3.600 1.4e-07
astrocytic glioma -1.600 3.9e-03
posterior fossa group B ependymoma -2.200 3.8e-07
oligodendroglioma -1.600 1.9e-18
glioblastoma -2.400 1.1e-03
group 4 medulloblastoma -2.400 8.9e-06
atypical teratoid / rhabdoid tumor -2.300 3.1e-05
medulloblastoma, large-cell -2.900 2.1e-04
primitive neuroectodermal tumor -2.300 2.0e-03
intraductal papillary-mucinous adenoma (... -1.100 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.200 4.9e-02
lung cancer 4.500 2.7e-06
adult high grade glioma -3.000 2.8e-07
pituitary cancer 2.600 5.9e-05

Gene RIF (15)

PMID Text
26397940 These findings indicate that downregulated AJAP1 transcription may serve as a novel tumor biomarker to predict recurrence of ESCC after esophagectomy.
26122373 Reduced Expression of Adherens Junctions Associated Protein 1 is associated with Recurrence of Hepatocellular Carcinoma After Curative Hepatectomy.
24807315 Article summarizes and discusses current knowledge that may identify AJAP1 as a tumor suppressor in gliomas. [Review]
24483339 Results show that AJAP1 is dysregulated at an early stage of gliomagenesis and may suppress glioma cell invasion and proliferation, which suggests that AJAP1 may be a potential diagnostic and prognostic marker for gliomas
24481586 AJAP1 suppressed the expression of MAGEA2 and inhibited the transcriptional activity of MAGEA2 in glioma cells.
23064961 We also identified a significant genetic association between caries of the mid- dentition tooth surfaces and AJAP1 (p value = 2e-8), a gene possibly involved in tooth development.
22241217 This work shows the significant loss of expression of AJAP1 in glioblastoma and provides evidence of its role in the highly migratory characteristic of these tumors.
21439246 Both genetic (gene deletion) and epigenetic alterations (promoter methylation) are likely mechanisms that inactivate the putative tumor suppressor AJAP1 in gliomas, which contributes to poor prognosis.
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19515834 Data show that overexpression of shrew-1 leads to preformation of an E-cadherin/EGF receptor/HER2/src-kinase/shrew-1 signaling complex and accelerated E-cadherin internalization.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18485053 synergism between a signal peptide and a transmembrane segment to mediate plasma membrane localization is essential for structural and/or functional integrity of shrew-1
17267690 shrew-1 has a function in the regulation of cellular invasion, which may involve its interaction with CD147
16707570 Adaptor protein complex AP-1B is involved in retaining shrew-1 at the basolateral membrane by postendocytic sorting mechanisms.
16410724 While a mutation was not detected in the coding region of the SHREW1 gene in oligodendrogliomas, SHREW1 expression restoration resulted in suppression of cell adhesion and migration, thus, SHREW1 inactivation may lead to oligodendroglial tumorigenesis.

AA Sequence

MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRPPRLWSFRSGQ      1 - 70
PARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSA     71 - 140
VAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQ    141 - 210
TRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAV    211 - 280
HQIITITVSLIMVIAALITTLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAY    281 - 350
NETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC             351 - 411
//

Text Mined References (22)

PMID Year Title
26397940 2015 Adherens junctions associated protein 1 serves as a predictor of recurrence of squamous cell carcinoma of the esophagus.
26122373 2015 Reduced Expression of Adherens Junctions Associated Protein 1 Predicts Recurrence of Hepatocellular Carcinoma After Curative Hepatectomy.
24807315 2014 Adherens junctional associated protein-1: a novel 1p36 tumor suppressor candidate in gliomas (Review).
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24483339 2014 AJAP1 is dysregulated at an early stage of gliomagenesis and suppresses invasion through cytoskeleton reorganization.
24481586 2014 The adherens junction-associated protein 1 is a negative transcriptional regulator of MAGEA2, which potentiates temozolomide-induced apoptosis in GBM.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22241217 2012 Deletion or epigenetic silencing of AJAP1 on 1p36 in glioblastoma.
21439246 2011 Tumor-associated methylation of the putative tumor suppressor AJAP1 gene and association between decreased AJAP1 expression and shorter survival in patients with glioma.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19515834 2009 E-cadherin surface levels in epithelial growth factor-stimulated cells depend on adherens junction protein shrew-1.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18485053 2008 Synergism of shrew-1's signal peptide and transmembrane segment required for plasma membrane localization.
17267690 2007 Junction protein shrew-1 influences cell invasion and interacts with invasion-promoting protein CD147.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16707570 2006 Targeting of transmembrane protein shrew-1 to adherens junctions is controlled by cytoplasmic sorting motifs.
16410724 2006 The SHREW1 gene, frequently deleted in oligodendrogliomas, functions to inhibit cell adhesion and migration.
14595118 2004 Novel membrane protein shrew-1 targets to cadherin-mediated junctions in polarized epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.