| Tbio | Adherens junction-associated protein 1 |
Plays a role in cell adhesion and cell migration.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| oligodendroglioma | 2849 | 1.9e-18 |
| malignant mesothelioma | 3163 | 1.4e-07 |
| adult high grade glioma | 2148 | 2.8e-07 |
| posterior fossa group B ependymoma | 1530 | 3.8e-07 |
| lung cancer | 4473 | 2.7e-06 |
| group 4 medulloblastoma | 1875 | 8.9e-06 |
| atypical teratoid / rhabdoid tumor | 4369 | 3.1e-05 |
| pituitary cancer | 1972 | 5.9e-05 |
| medulloblastoma, large-cell | 6234 | 2.1e-04 |
| glioblastoma | 5572 | 1.1e-03 |
| primitive neuroectodermal tumor | 3031 | 2.0e-03 |
| astrocytic glioma | 2241 | 3.9e-03 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 1.4e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 4.9e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Dental caries | 67 | 3.382 | 1.7 |
| Celiac disease | 112 | 0.0 | 1.0 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Chromosome 1p36 deletion syndrome | 24 | 3.472 | 1.7 |
| Choroid Plexus Papilloma | 10 | 3.022 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | 3.600 | 1.4e-07 |
| astrocytic glioma | -1.600 | 3.9e-03 |
| posterior fossa group B ependymoma | -2.200 | 3.8e-07 |
| oligodendroglioma | -1.600 | 1.9e-18 |
| glioblastoma | -2.400 | 1.1e-03 |
| group 4 medulloblastoma | -2.400 | 8.9e-06 |
| atypical teratoid / rhabdoid tumor | -2.300 | 3.1e-05 |
| medulloblastoma, large-cell | -2.900 | 2.1e-04 |
| primitive neuroectodermal tumor | -2.300 | 2.0e-03 |
| intraductal papillary-mucinous adenoma (... | -1.100 | 1.4e-02 |
| intraductal papillary-mucinous neoplasm ... | -1.200 | 4.9e-02 |
| lung cancer | 4.500 | 2.7e-06 |
| adult high grade glioma | -3.000 | 2.8e-07 |
| pituitary cancer | 2.600 | 5.9e-05 |
| PMID | Text | |
|---|---|---|
| 26397940 | These findings indicate that downregulated AJAP1 transcription may serve as a novel tumor biomarker to predict recurrence of ESCC after esophagectomy. | |
| 26122373 | Reduced Expression of Adherens Junctions Associated Protein 1 is associated with Recurrence of Hepatocellular Carcinoma After Curative Hepatectomy. | |
| 24807315 | Article summarizes and discusses current knowledge that may identify AJAP1 as a tumor suppressor in gliomas. [Review] | |
| 24483339 | Results show that AJAP1 is dysregulated at an early stage of gliomagenesis and may suppress glioma cell invasion and proliferation, which suggests that AJAP1 may be a potential diagnostic and prognostic marker for gliomas | |
| 24481586 | AJAP1 suppressed the expression of MAGEA2 and inhibited the transcriptional activity of MAGEA2 in glioma cells. | |
| 23064961 | We also identified a significant genetic association between caries of the mid- dentition tooth surfaces and AJAP1 (p value = 2e-8), a gene possibly involved in tooth development. | |
| 22241217 | This work shows the significant loss of expression of AJAP1 in glioblastoma and provides evidence of its role in the highly migratory characteristic of these tumors. | |
| 21439246 | Both genetic (gene deletion) and epigenetic alterations (promoter methylation) are likely mechanisms that inactivate the putative tumor suppressor AJAP1 in gliomas, which contributes to poor prognosis. | |
| 19850283 | Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19515834 | Data show that overexpression of shrew-1 leads to preformation of an E-cadherin/EGF receptor/HER2/src-kinase/shrew-1 signaling complex and accelerated E-cadherin internalization. | |
| 19240061 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18485053 | synergism between a signal peptide and a transmembrane segment to mediate plasma membrane localization is essential for structural and/or functional integrity of shrew-1 | |
| 17267690 | shrew-1 has a function in the regulation of cellular invasion, which may involve its interaction with CD147 | |
| 16707570 | Adaptor protein complex AP-1B is involved in retaining shrew-1 at the basolateral membrane by postendocytic sorting mechanisms. | |
| 16410724 | While a mutation was not detected in the coding region of the SHREW1 gene in oligodendrogliomas, SHREW1 expression restoration resulted in suppression of cell adhesion and migration, thus, SHREW1 inactivation may lead to oligodendroglial tumorigenesis. |
MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRPPRLWSFRSGQ 1 - 70 PARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSA 71 - 140 VAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQ 141 - 210 TRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAV 211 - 280 HQIITITVSLIMVIAALITTLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAY 281 - 350 NETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC 351 - 411 //
| PMID | Year | Title | |
|---|---|---|---|
| 26397940 | 2015 | Adherens junctions associated protein 1 serves as a predictor of recurrence of squamous cell carcinoma of the esophagus. | |
| 26122373 | 2015 | Reduced Expression of Adherens Junctions Associated Protein 1 Predicts Recurrence of Hepatocellular Carcinoma After Curative Hepatectomy. | |
| 24807315 | 2014 | Adherens junctional associated protein-1: a novel 1p36 tumor suppressor candidate in gliomas (Review). | |
| 24556642 | 2014 | Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries. | |
| 24483339 | 2014 | AJAP1 is dysregulated at an early stage of gliomagenesis and suppresses invasion through cytoskeleton reorganization. | |
| 24481586 | 2014 | The adherens junction-associated protein 1 is a negative transcriptional regulator of MAGEA2, which potentiates temozolomide-induced apoptosis in GBM. | |
| 23793025 | 2013 | Genome-wide meta-analysis identifies new susceptibility loci for migraine. | |
| 23064961 | 2013 | GWAS of dental caries patterns in the permanent dentition. | |
| 22241217 | 2012 | Deletion or epigenetic silencing of AJAP1 on 1p36 in glioblastoma. | |
| 21439246 | 2011 | Tumor-associated methylation of the putative tumor suppressor AJAP1 gene and association between decreased AJAP1 expression and shorter survival in patients with glioma. | |
| 19850283 | 2010 | Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches. | |
| 19515834 | 2009 | E-cadherin surface levels in epithelial growth factor-stimulated cells depend on adherens junction protein shrew-1. | |
| 19240061 | 2009 | Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling. | |
| 18485053 | 2008 | Synergism of shrew-1's signal peptide and transmembrane segment required for plasma membrane localization. | |
| 17267690 | 2007 | Junction protein shrew-1 influences cell invasion and interacts with invasion-promoting protein CD147. | |
| 16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. | |
| 16707570 | 2006 | Targeting of transmembrane protein shrew-1 to adherens junctions is controlled by cytoplasmic sorting motifs. | |
| 16410724 | 2006 | The SHREW1 gene, frequently deleted in oligodendrogliomas, functions to inhibit cell adhesion and migration. | |
| 14595118 | 2004 | Novel membrane protein shrew-1 targets to cadherin-mediated junctions in polarized epithelial cells. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 9110174 | 1997 | Large-scale concatenation cDNA sequencing. | |
| 8619474 | 1996 | A "double adaptor" method for improved shotgun library construction. |
