Property Summary

NCBI Gene PubMed Count 59
PubMed Score 26.15
PubTator Score 25.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.100 2.2e-05
astrocytoma 1.200 4.5e-03
glioblastoma 1.100 4.0e-09
group 3 medulloblastoma 1.100 3.3e-04
lung adenocarcinoma 1.100 9.9e-08
lung cancer 1.800 3.2e-02
medulloblastoma, large-cell 1.600 2.2e-05
non primary Sjogren syndrome sicca 1.200 1.9e-02
ovarian cancer 1.600 3.8e-04

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELK      1 - 70
AAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHR     71 - 140
LLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGE    141 - 210
GNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVV    211 - 280
LWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK                                  281 - 320
//

Text Mined References (65)

PMID Year Title