Property Summary

NCBI Gene PubMed Count 71
PubMed Score 136.61
PubTator Score 184.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Protein-protein Interaction (13)

Gene RIF (48)

PMID Text
27089716 Increased serum level of EMAP-II may be one of the pathways of endothelial dysfunction in type 1 diabetes.
26325028 AIMp1 promotes the proliferation and migration of fibroblasts/endothelial cells and importantly, pro-inflammatory gene expression in monocytes/macrophages and dendritic cells.
26173967 two homozygous missense variants, p.(Gly299Arg) and p.(Val176Gly), in the gene AIMP1 that co-segregated with the phenotype, are reported.
26142824 findings suggest EMAP II is elevated in type 1 diabetic patients, particularly those with micro-vascular complications; EMAP II levels are related to inflammation, glycemic control, albuminuria level of patients and the risk of micro-vascular complications
26040042 EMAP2 is a multifunctional polypeptide with proinflammatory and antiangiogenic activity. (Review)
25724651 Data indicate that the N terminus of Pro-EMAP II binds to its C terminus, arginyl-tRNA synthetase, and the neurofilament light subunit.
25288775 interactions between the N-terminal domains of ArgRS and AIMP1 are important for the catalytic and noncatalytic activities of ArgRS and for the assembly of the higher-order MSC protein complex with ArgRS-GlnRS-AIMP1
25146391 AIMP1 appears to function as a novel inhibitor of PPARgamma that regulates adipocyte differentiation by preventing the transcriptional activation of PPARgamma.
25010285 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1) is identified in a series of six affinity purification/mass spectrometry screens
24816397 Data indicate that HCV E2 glycoprotein interacts with cellular AIMP1/p43 protein and promotes cell surface expression of membrane glycoproteins gp96 and transforming growth factor beta TGF-beta signaling.
24619875 vascular contribution to lung development and the implications that vascular mediators such as EMAP II have in distal lung formation during the vulnerable stage of alveolar genesis.
24395571 Kisspeptin effect on endothelial monocyte activating polypeptide II (EMAP-II)-associated lymphocyte cell death and metastases in colorectal cancer patients
23672191 AIMP1 peptide promotes the proliferation of BMMSCs by activating the beta-catenin/TCF complex via FGFR2-mediated activation of Akt, which leads to an increase in mesenchymal stem cells in peripheral blood.
23082492 EMAP-II transcripts are upregulated in tumour cells in hypoxic conditions.
22767513 Downregulation of CD23 attenuated AIMP1-induced TNF-alpha secretion and AIMP1 binding.
22412987 EMAP II has specific intracellular effects, and that this intracellular function appears to antagonize its extracellular anti-angiogenic effects during fetal development and pulmonary disease progression.
22190034 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1) is identified in a series of six affinity purification/mass spectrometry screens
21789020 Decreased expression of AIMP1 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC.
21576822 EMAPII is elevated in the BALF of active smokers and patients with COPD. Expression was increased in COPD lungs and emphysema.
21416500 we propose that AIMP1 effect on EC adhesion is mediated by the assembly of a cytoskeletal protein complex on the cytosolic face of the cell membrane
21092922 Through genome-wide homozygosity mapping and mutation analysis, we demonstrated in all affected individuals a homozygous frameshift mutation that fully abrogates the main active domain of AIMP1
21047177 The known pathological functions together with abundant cellular accumulation in cerebral ischemia lesions suggest that EMAPII might contribute to pathophysiological consequences of cerebral ischemia.
20510162 LPS induces the dissociation of gp96 from AIMP1 by phosphorylation through TLR4/MyD88-mediated JNK activation, resulting in translocation of gp96 on the cell surface.
20429837 autoantibodies of aminoacyl-tRNA synthetase can be used in the diagnosis of type I diabetes
20413730 p43 is cleaved during apoptosis by calpains and released as a truncated protein that is harmless for the structure of the atherosclerotic plaque.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19917687 this is the first report showing evidence for the chemoattractant properties of EMAPII on leech and human microglial cells
19573982 AIMP1 may exert its antitumor activity by inducing tumor-suppressing cytokines. After a single intravenous injection, AMP1 exhibited a low clearance showing a one-compartmental disposition.
19565673 EMAP-II plays an important role in endothelial cell dysfunction related to graft-versus-host disease after allogeneic stem cell transplantation.
19460752 Knockdown of aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19362550 one of the major anti-angiogenic functions of EMAP-II is exerted through its inhibition of the HIF-1alpha activities
19002109 Inhibition of VEGF signaling is one possible antiangiogenic mechanism of EMAP II, which may explain its in vivo antitumor activity and delineate therapeutic strategies to enhance anti-VEGF therapy to inhibit tumor growth.
18951814 Results suggest novel roles for EMAP II in modulating the migration of dendritic cells and suggest that these effects may modify Meth A tumor/host interactions.
18621627 serum EMAP-II levels are significantly higher in patients with NSCLC than in healthy subjects and suggest it is of potential prognostic value
17443684 Arginyl t-RNA synthetase over-expression associates with a reduced AIMP1 secretion. Multicatalytic protease is involved in the generation of the mature cytokine, EMAP II.
17303557 suggest that the cleavage of p43 and its cellular delocalization
17051333 EMAP-II facilitates apoptotic signaling of TNF-R1 via mobilization of TRADD.
17018011 Three-dimensional structure is projected from amino acid sequence.
16674941 EMAP II is cleaved by MMP-9, elastase, and cathepsin L.
16615114 Expression of the cleaved EMAP-II form in tumour-biopsies correlates with a good response of melanoma patients to TNF-based ILP.
15935955 DOC1 might play a role in mediating some of the effects of EMAP-II on endothelial cells
15857508 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1) is identified in a series of six affinity purification/mass spectrometry screens
14982944 EMAP-II causes a dose-dependent inhibition of proliferation and apoptosis in Jurkat T cells and mitogen-activated peripheral blood mononuclear cells, suggesting that EMAP-II constitutes a component of a novel, immunosuppressive pathway in solid tumors
14688335 Membrane-bound and soluble EMAP-II appear to play multiple roles in the tumor microenvironment, one of which is to assist in immune evasion.
14588117 Expression of endothelial monocyte activating polypeptide II is increased after spinal cord injury (SCI), suggesting a role for EMAP II in the pathophysiology of secondary injury following SCI.
12543078 p43-induced TNF production was mediated by the activation of MAPK family members, ERK and p38 MAPK, and by IkappaB degradation leading to the activation of NFkappaB.
12161535 temporal variation in EMAP II expression in the human endometrium across the menstrual cycle and localize expression to glandular epithelial, endothelial, and stromal cells. Moreover, EMAP II expression is negatively regulated by PGE(2).
11741979 These results suggest the potential interaction of p43/EMAP II with alpha-ATP synthase and its role in the proliferation of endothelial cells.

AA Sequence

MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAE      1 - 70
IQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQS     71 - 140
IAGSADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILL    141 - 210
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT    211 - 280
NDECVATYKGVPFEVKGKGVCRAQTMSNSGIK                                          281 - 312
//

Text Mined References (83)

PMID Year Title
27089716 [SERUM LEVEL OF ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE-II IN CHILDHOOD-ONSET TYPE 1 DIABETIC PATIENTS AND OBESE ADOLESCENTS].
26325028 2015 Stepping Out of the Cytosol: AIMp1/p43 Potentiates the Link Between Innate and Adaptive Immunity.
26173967 2016 Missense variants in AIMP1 gene are implicated in autosomal recessive intellectual disability without neurodegeneration.
26142824 2015 Endothelial monocyte activating polypeptide II in children and adolescents with type 1 diabetes mellitus: Relation to micro-vascular complications.
26040042 2015 [Endothelial monocyte-activating polypeptide-II: properties, functions, and pathogenetic significance].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25724651 2015 The N terminus of pro-endothelial monocyte-activating polypeptide II (EMAP II) regulates its binding with the C terminus, arginyl-tRNA synthetase, and neurofilament light protein.
25416956 2014 A proteome-scale map of the human interactome network.
25288775 2014 Structure of the ArgRS-GlnRS-AIMP1 complex and its implications for mammalian translation.
25146391 2014 AIMP1 negatively regulates adipogenesis by inhibiting PPAR?.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24816397 2014 Degradation of AIMP1/p43 induced by hepatitis C virus E2 leads to upregulation of TGF-? signaling and increase in surface expression of gp96.
24619875 2014 Vascular mediators in chronic lung disease of infancy: role of endothelial monocyte activating polypeptide II (EMAP II).
24395571 2014 Kisspeptin effect on endothelial monocyte activating polypeptide II (EMAP-II)-associated lymphocyte cell death and metastases in colorectal cancer patients.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23672191 2013 ARS-interacting multi-functional protein 1 induces proliferation of human bone marrow-derived mesenchymal stem cells by accumulation of ?-catenin via fibroblast growth factor receptor 2-mediated activation of Akt.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23082492 2010 Hypoxia-induced EMAP-II transcription in colorectal cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22767513 2012 Identification of CD23 as a functional receptor for the proinflammatory cytokine AIMP1/p43.
22412987 2012 Cell proliferation and migration are modulated by Cdk-1-phosphorylated endothelial-monocyte activating polypeptide II.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
21789020 Expression of AIMP1, 2 and 3, the scaffolds for the multi-tRNA synthetase complex, is downregulated in gastric and colorectal cancer.
21576822 2011 Lung endothelial monocyte-activating protein 2 is a mediator of cigarette smoke-induced emphysema in mice.
21416500 2011 The activity of aminoacyl-tRNA synthetase-interacting multi-functional protein 1 (AIMP1) on endothelial cells is mediated by the assembly of a cytoskeletal protein complex.
21269460 2011 Initial characterization of the human central proteome.
21092922 2010 Pelizaeus-Merzbacher-like disease caused by AIMP1/p43 homozygous mutation.
21047177 2011 Lesional expression of EMAPII in macrophages/microglia following cerebral ischemia in rats.
20510162 2010 Toll-like receptor 4-mediated c-Jun N-terminal kinase activation induces gp96 cell surface expression via AIMP1 phosphorylation.
20429837 2010 Autoantibodies against aminoacyl-tRNA synthetase: novel diagnostic marker for type 1 diabetes mellitus.
20413730 2010 Cell death-mediated cleavage of the attraction signal p43 in human atherosclerosis: implications for plaque destabilization.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19917687 2009 Deciphering the immune function and regulation by a TLR of the cytokine EMAPII in the lesioned central nervous system using a leech model.
19573982 2010 Antitumor activity and pharmacokinetic properties of ARS-interacting multi-functional protein 1 (AIMP1/p43).
19565673 2009 The significance of EMAP-II after allogeneic stem cell transplantation.
19362550 2009 Endothelial monocyte activating polypeptide-II modulates endothelial cell responses by degrading hypoxia-inducible factor-1alpha through interaction with PSMA7, a component of the proteasome.
19002109 2009 Endothelial monocyte activating polypeptide II interferes with VEGF-induced proangiogenic signaling.
18951814 2008 The impact of Meth A fibrosarcoma derived EMAP II on dendritic cell migration.
18621627 2008 Serum endothelial monocyte-activating polypeptide-II: a novel biomarker in patients with non-small-cell lung cancer.
17443684 2007 Proteasomes and RARS modulate AIMP1/EMAP II secretion in human cancer cell lines.
17303557 2007 Characterization of p43(ARF), a derivative of the p43 component of multiaminoacyl-tRNA synthetase complex released during apoptosis.
17051333 2006 EMAP-II facilitates TNF-R1 apoptotic signalling in endothelial cells and induces TRADD mobilization.
17018011 2006 Web-ware bioinformatical analysis and structure modelling of N-terminus of human multisynthetase complex auxiliary component protein p43.
16674941 2006 Identification of protease-sensitive sites in Human Endothelial-Monocyte Activating Polypeptide II protein.
16615114 2006 Intratumoural expression of TNF-R1 and EMAP-II in relation to response of patients treated with TNF-based isolated limb perfusion.
16472771 2006 Structural separation of different extracellular activities in aminoacyl-tRNA synthetase-interacting multi-functional protein, p43/AIMP1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055448 2005 The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.
15935955 2005 Endothelial monocyte activating polypeptide-II induced gene expression changes in endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14982944 2004 Endothelial monocyte-activating polypeptide-II (EMAP-II): a novel inducer of lymphocyte apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688335 2004 Colorectal cancer cells induce lymphocyte apoptosis by an endothelial monocyte-activating polypeptide-II-dependent mechanism.
14588117 2003 Spinal cord injury induces lesional expression of the proinflammatory and antiangiogenic cytokine EMAP II.
14500886 2003 Isolation and characterization of human nuclear and cytosolic multisynthetase complexes and the intracellular distribution of p43/EMAPII.
12729910 2003 Solution structure and p43 binding of the p38 leucine zipper motif: coiled-coil interactions mediate the association between p38 and p43.
12543078 2002 Signaling pathways for TNF production induced by human aminoacyl-tRNA synthetase-associating factor, p43.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237313 2002 Dose-dependent biphasic activity of tRNA synthetase-associating factor, p43, in angiogenesis.
12161535 2002 Expression and localization of endothelial monocyte-activating polypeptide II in the human endometrium across the menstrual cycle: regulation of expression by prostaglandin E(2).
11818442 2002 Monocyte cell adhesion induced by a human aminoacyl-tRNA synthetase-associated factor, p43: identification of the related adhesion molecules and signal pathways.
11741979 2002 Interaction of the C-terminal domain of p43 and the alpha subunit of ATP synthase. Its functional implication in endothelial cell proliferation.
11714285 2001 The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.
11306575 2001 The EMAPII cytokine is released from the mammalian multisynthetase complex after cleavage of its p43/proEMAPII component.
11157763 2001 Structure of the EMAPII domain of human aminoacyl-tRNA synthetase complex reveals evolutionary dimer mimicry.
10852899 2000 A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases.
10850427 2000 Prostate adenocarcinoma cells release the novel proinflammatory polypeptide EMAP-II in response to stress.
10409428 1999 Gene expression in proliferating human erythroid cells.
10358004 1999 Precursor of pro-apoptotic cytokine modulates aminoacylation activity of tRNA synthetase.
9878398 1999 Macromolecular assemblage of aminoacyl-tRNA synthetases: identification of protein-protein interactions and characterization of a core protein.
9405472 1997 The p43 component of the mammalian multi-synthetase complex is likely to be the precursor of the endothelial monocyte-activating polypeptide II cytokine.
9278442 1997 Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.
8449960 1993 Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.
8188258 1994 The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.
8078941 1994 Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.
8052601 1994 Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.
7929199 1994 Characterization of a novel tumor-derived cytokine. Endothelial-monocyte activating polypeptide II.
7545917 1994 A peptide derived from the amino terminus of endothelial-monocyte-activating polypeptide II modulates mononuclear and polymorphonuclear leukocyte functions, defines an apparently novel cellular interaction site, and induces an acute inflammatory response.
1400342 1992 Endothelial monocyte-activating polypeptide II. A novel tumor-derived polypeptide that activates host-response mechanisms.