Property Summary

NCBI Gene PubMed Count 57
PubMed Score 140.74
PubTator Score 117.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma 1.100 4.6e-03
chronic lymphosyte leukemia 1.300 1.1e-06
cutaneous lupus erythematosus 5.400 2.5e-06
psoriasis 2.800 7.5e-112
tuberculosis 1.400 4.1e-03
non-small cell lung cancer 1.107 1.1e-04
lung cancer -1.600 6.0e-04
sarcoidosis 1.600 3.9e-02
interstitial cystitis 3.300 3.7e-03
cystic fibrosis 1.100 2.5e-02
lung adenocarcinoma 1.800 3.2e-08
group 3 medulloblastoma 1.500 7.5e-05
posterior fossa group B ependymoma 1.300 9.8e-05
primary Sjogren syndrome 1.900 1.2e-03
subependymal giant cell astrocytoma 1.184 1.2e-02
mucosa-associated lymphoid tissue lympho... 1.612 3.0e-02
invasive ductal carcinoma 1.200 1.5e-02
ulcerative colitis 3.100 1.4e-06
ovarian cancer 1.300 3.2e-04
pituitary cancer 1.100 9.2e-05
head and neck cancer and chronic obstruc... 1.400 1.9e-02

 GO Function (1)

Gene RIF (44)

PMID Text
27037024 Molecular docking analysis reveals that the conformation switching may be important for the autoinhibition of the AIM2 protein.
26506473 Lung tumor-associated plasmacytoid dendritic cells (pDCs) are responsive to the activation of AIM2 that promotes calcium efflux and reactive oxygen species from mitochondria, leading to calpain activation and high levels of IL-1alpha.
26378020 The extent of NLRC3 and AIM2 gene reduction was correlated with cancer progression.
26313692 A significant upregulation of the PYHIN inflammasomes AIM2 and IFI16 in active inflammatory bowel disease versus controls was found.
26258904 analysis of a subset of inflammasome receptors including NLRP3, NLRC4 and AIM2 that triggers formation of the micrometer-sized spherical supramolecular complex called the ASC speck
26197926 pyrin domain drives both filament formation and dsDNA binding
25888795 The comparison shows mouse AIM2 PYD domain adopts a unique alpha2-alpha3 helix conformation distinct from its human homologues, but similar to the pyrin domain of human NLRP10/PYNOD, which belongs to another family.
25173967 activation of the AIM2 inflammasome did not require a priming signal in ascitic fluid-derived macrophages, demonstrating the preactivated state of the inflammasome in these cells.
25164813 EB1 has a role in linking AIM2 inflammasomes with autophagy-dependent secretion
24986444 These results suggest that AIM2 expressed in human dental pulp plays an important role in the immune defense by activating the inflammasome signaling pathway.
24971542 Thus, autophagy may function as a negative counter-regulatory mechanism for HMGB1-DNA complex-induced inflammasome activation, and provide a checkpoint to limit the development of inflammation.
24729378 Lack of Absent in Melanoma 2 expression is associated with colorectal cancer.
24701032 caspase-1, IL-1beta, and IL-18 are regulated by AIM2, which mediates inflammation-associated renal damage in hepatitis B virus-associated glomerulonephritis
24618883 Increased expression and activation of absent in melanoma 2 inflammasome components in lymphocytic infiltrates of abdominal aortic aneurysms
24419611 These results, together with the reported data on p202 HINb, lead to an interaction model for full-length p202 and dsDNA which provides a conceivable mechanism for the negative regulation of Aim2 inflammasome activation by p202.
24244322 Ethanol inhibits activation of NLRP3 and AIM2 inflammasomes in human macrophages--a novel anti-inflammatory action of alcohol.
24164899 Studies indicate that the HIN (hematopoietic expression, interferon-inducible nature, and nuclear localization) domains exhibit either absent in melanoma2 (Aim2) HIN-like or p202 HINa-like modes of DNA binding.
23864729 AIM2 mRNA levels were higher in benign prostate hyperplasia (BPH)than normal prostate; levels of AIM2 mRNA were lower in clinical tumor specimens; constitutive levels of AIM2 mRNA and protein were lower in a subset of prostate cancer cells compared with BPH cells; Implication that AIM2 inflammasome has a fundamental role in the generation of prostatic diseases
23811549 this study was to investigate the mRNA levels of AIM2 and ASC in a lymphocyte cell line (Jurkat) before and after MiR-143 introducing.
23790454 Vascular endothelial/smooth muscle cells are able to respond to inflammatory signals by upregulation of AIM2 expression, indicating a role of AIM2 in vascular pathogenesis.
23764897 Binding of Human papillomavirus 16 DNA leads to AIM2 inflammasome activation.
23530044 Novel structural features of the AIM2 pyrin domain and insights into the potential mechanisms of domain interactions important for AIM2 autoinhibition and inflammasome assembly.
23479181 AIM2 might act as an important DNA sensor and a potential biomarker for apopDNA-induced macrophage functional maturation and SLE disease
23376086 Data suggest that AIM2 (absent in melanoma 2) expression is correlated with the immune clearance of hepatitis B virus (HBV) in the host.
23171461 Our data highlight the dynamics of epidermal AIM2 expression, showing Langerhans cell and melanocyte-restricted expression in normal epidermis but a pronounced induction in subpopulations of epidermal keratinocytes under inflammatory conditions.
22869553 End binding protein 1 directly interacted with AIM2 and ASC in vitro and in vivo.
22483801 crystal structures of their HIN domains in complex with double-stranded (ds) DNA.
22320325 expression of AIM2 and IFI16 may have oncogenic activities in the OSCC cells that have inactivated the p53 system.
22140256 a pathway activating DNA damage signaling plays an important independent role in detecting intracellular foreign DNA, thereby complementing the induction of IFN and activation of the AIM2 inflammasome
22092578 Human keratinocytes express a functional AIM2 inflammasome which triggers a strong IL-1beta release in response to cytosolic dsDNA.
21883803 The author show that Francisella mutant strains deficient for membrane-associated proteins or deficient for genes involved in O-antigen or LPS biosynthesis lyse more intracellularly, thus activating AIM2-dependent pyroptosis.
21804607 data indicate that AIM2 mediates both IFN-gamma dependent and independent induction of several interferon-stimulated genes
21550598 supragingival and subgingival biofilms differentially regulate the gene expressions of AIM2 in gingival fibroblasts
21471287 Differential roles for the interferon-inducible IFI16 and AIM2 innate immune sensors for cytosolic DNA in cellular senescence of human fibroblasts
20595294 Observational study of gene-disease association. (HuGE Navigator)
20401524 [REVIEW] role of AIM2 in innate immunity against F. tularensis in particular, and how infection of macrophages with this pathogen is thought to activate AIM2
19795419 AIM2 mediates reduction of cell proliferation by cell cycle arrest, thereby conferring an invasive phenotype in colon cancer cells.
19293232 The AIM2 influenced core 1 mucin-type O-glycosylation differentially, downregulation by AIM2.
19158676 identification of AIM2 as an important inflammasome component that senses potentially dangerous cytoplasmic DNA, leading to activation of the ASC pyroptosome and caspase-1
19158675 observations identify AIM2 as a new receptor for cytoplasmic DNA, which forms an inflammasome with the ligand and ASC to activate caspase-1
17726700 inactivation of AIM2 by genetic and epigenetic mechanisms is frequent in Mismatch repair -deficient colorectal cancers, thus suggesting that AIM2 is a mutational target relevant for the progression of MSI-H colorectal cancers.
16432157 AIM2 associates with tumor suppression activity
15582594 AIM2 could homodimerise via the amino-terminal (PAAD/DAPIN) region and heterodimerise with the related IFI 16 protein
15076139 AIM-2 antigen is expressed in glioblastoma multiforme (GBM) in primary cultured cells and established GBM cell lines

AA Sequence

MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQ      1 - 70
KLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVA     71 - 140
QQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIA    141 - 210
RYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNI    211 - 280
LFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT           281 - 343
//

Text Mined References (61)

PMID Year Title
27037024 2016 Conformation switching of AIM2 PYD domain revealed by NMR relaxation and MD simulation.
26506473 2015 Human lung cancer-derived immunosuppressive plasmacytoid dendritic cells release IL-1? in an AIM2 inflammasome-dependent manner.
26378020 2015 Expression profile of innate immune receptors, NLRs and AIM2, in human colorectal cancer: correlation with cancer stages and inflammasome components.
26313692 2015 Strong Upregulation of AIM2 and IFI16 Inflammasomes in the Mucosa of Patients with Active Inflammatory Bowel Disease.
26258904 2015 Artificial Loading of ASC Specks with Cytosolic Antigens.
26197926 2015 Assembly-driven activation of the AIM2 foreign-dsDNA sensor provides a polymerization template for downstream ASC.
25888795 2015 The NMR solution structure of AIM2 PYD domain from Mus musculus reveals a distinct ?2-?3 helix conformation from its human homologues.
25173967 2015 Absent in melanoma 2 triggers a heightened inflammasome response in ascitic fluid macrophages of patients with cirrhosis.
25164813 2014 The microtubule-associated protein EB1 links AIM2 inflammasomes with autophagy-dependent secretion.
24986444 2015 Absent in melanoma 2 (AIM2) expressed in human dental pulp mediates IL-1? secretion in response to cytoplasmic DNA.
24971542 2014 HMGB1-DNA complex-induced autophagy limits AIM2 inflammasome activation through RAGE.
24729378 2014 Lack of Absent in Melanoma 2 (AIM2) expression in tumor cells is closely associated with poor survival in colorectal cancer patients.
24701032 2014 AIM2 mediates inflammation-associated renal damage in hepatitis B virus-associated glomerulonephritis by regulating caspase-1, IL-1?, and IL-18.
24630722 2014 Unified polymerization mechanism for the assembly of ASC-dependent inflammasomes.
24618883 2014 Increased expression and activation of absent in melanoma 2 inflammasome components in lymphocytic infiltrates of abdominal aortic aneurysms.
24419611 2014 Structural mechanism of DNA recognition by the p202 HINa domain: insights into the inhibition of Aim2-mediated inflammatory signalling.
24244322 2013 Ethanol inhibits activation of NLRP3 and AIM2 inflammasomes in human macrophages--a novel anti-inflammatory action of alcohol.
24237704 2013 Human cytomegalovirus tegument protein pUL83 inhibits IFI16-mediated DNA sensing for immune evasion.
24164899 2014 Role of the HIN domain in regulation of innate immune responses.
23864729 2013 AIM2, an IFN-inducible cytosolic DNA sensor, in the development of benign prostate hyperplasia and prostate cancer.
23811549 2013 MiR-143 induces expression of AIM2 and ASC in Jurkat cell line.
23790454 2014 Inflammation-related induction of absent in melanoma 2 (AIM2) in vascular cells and atherosclerotic lesions suggests a role in vascular pathogenesis.
23764897 2013 HPV16 activates the AIM2 inflammasome in keratinocytes.
23530044 2013 Structure of the absent in melanoma 2 (AIM2) pyrin domain provides insights into the mechanisms of AIM2 autoinhibition and inflammasome assembly.
23479181 2013 AIM2 facilitates the apoptotic DNA-induced systemic lupus erythematosus via arbitrating macrophage functional maturation.
23376086 2013 Correlation of AIM2 expression in peripheral blood mononuclear cells from humans with acute and chronic hepatitis B.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23171461 2012 Strong induction of AIM2 expression in human epidermis in acute and chronic inflammatory skin conditions.
22869553 2012 Interactome-wide analysis identifies end-binding protein 1 as a crucial component for the speck-like particle formation of activated absence in melanoma 2 (AIM2) inflammasomes.
22801494 2012 Novel role of PKR in inflammasome activation and HMGB1 release.
22483801 2012 Structures of the HIN domain:DNA complexes reveal ligand binding and activation mechanisms of the AIM2 inflammasome and IFI16 receptor.
22320325 2012 Overexpression of the DNA sensor proteins, absent in melanoma 2 and interferon-inducible 16, contributes to tumorigenesis of oral squamous cell carcinoma with p53 inactivation.
22286270 2012 Activation of autophagy by inflammatory signals limits IL-1? production by targeting ubiquitinated inflammasomes for destruction.
22140256 2012 Cytosolic DNA triggers mitochondrial apoptosis via DNA damage signaling proteins independently of AIM2 and RNA polymerase III.
22092578 2011 Human keratinocytes express AIM2 and respond to dsDNA with IL-1? secretion.
22046441 2011 IFI16 protein mediates the anti-inflammatory actions of the type-I interferons through suppression of activation of caspase-1 by inflammasomes.
21883803 2011 Elevated AIM2-mediated pyroptosis triggered by hypercytotoxic Francisella mutant strains is attributed to increased intracellular bacteriolysis.
21804607 2012 Absent in Melanoma 2 (AIM2) is an important mediator of interferon-dependent and -independent HLA-DRA and HLA-DRB gene expression in colorectal cancers.
21550598 2011 Regulation of NLRP3 and AIM2 inflammasome gene expression levels in gingival fibroblasts by oral biofilms.
21471287 2011 Differential roles for the interferon-inducible IFI16 and AIM2 innate immune sensors for cytosolic DNA in cellular senescence of human fibroblasts.
20595294 2010 Association of IFI200 gene polymorphisms with susceptibility to systemic lupus erythematosus.
20566831 2010 Involvement of absent in melanoma 2 in inflammasome activation in macrophages infected with Listeria monocytogenes.
20401524 2010 Sensing cytoplasmic danger signals by the inflammasome.
19795419 2010 Restoration of absent in melanoma 2 (AIM2) induces G2/M cell cycle arrest and promotes invasion of colorectal cancer cells.
19293232 2009 Compensation of loss of protein function in microsatellite-unstable colon cancer cells (HCT116): a gene-dependent effect on the cell surface glycan profile.
19158679 2009 An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.
19158676 2009 AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.
19158675 2009 AIM2 recognizes cytosolic dsDNA and forms a caspase-1-activating inflammasome with ASC.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17726700 2007 The putative tumor suppressor AIM2 is frequently affected by different genetic alterations in microsatellite unstable colon cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16432157 2006 AIM2 suppresses human breast cancer cell proliferation in vitro and mammary tumor growth in a mouse model.
15582594 2005 Biochemical and growth regulatory activities of the HIN-200 family member and putative tumor suppressor protein, AIM2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15076139 AIM-2: a novel tumor antigen is expressed and presented by human glioma cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828447 2000 Cytoplasmic localization of the interferon-inducible protein that is encoded by the AIM2 (absent in melanoma) gene from the 200-gene family.
9865494 The Ifi 200 genes: an emerging family of IFN-inducible genes.
9242382 1997 Cloning a novel member of the human interferon-inducible gene family associated with control of tumorigenicity in a model of human melanoma.
8700511 1996 Isolation and characterization of genes associated with chromosome-6 mediated tumor suppression in human malignant melanoma.