Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.40
PubTator Score 108.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Breast cancer 1.300 3.5e-02
adult high grade glioma 1.900 5.4e-04
Astrocytoma, Pilocytic 3.100 3.8e-11
glioblastoma 1.700 2.1e-03
interstitial cystitis -1.300 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.2e-02
juvenile dermatomyositis 1.039 1.1e-10
lung cancer -1.600 8.7e-04
lung carcinoma -2.400 3.5e-24
malignant mesothelioma -4.900 9.3e-08
osteosarcoma -2.124 1.3e-03
ovarian cancer 1.300 7.4e-03
pancreatic cancer 1.100 2.1e-02
pituitary cancer 2.000 3.1e-03
posterior fossa group A ependymoma 1.200 1.5e-04
primary pancreatic ductal adenocarcinoma 1.214 2.3e-02
spina bifida -1.560 3.7e-02
subependymal giant cell astrocytoma 1.585 2.1e-02
tuberculosis -1.100 1.1e-04
urothelial carcinoma -1.800 9.4e-04
Waldenstrons macroglobulinemia 1.334 4.3e-02

 GO Function (1)

 Compartment GO Term (3)

Gene RIF (10)

AA Sequence

MEKRSSGRRSGRRRGSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDNASAEKKVKSPRAALDGGV      1 - 70
ASAASPESKPSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAPPASGPRAPAKESPPKRVPDP     71 - 140
SPVTKGTAAESGEEAARAIPRELPVKSSSLLPEIKPEHKRGPLPNHFNGRAEGGRSRELGRAAGAPGASD    141 - 210
ADGLKPRNHFGVGRSTVTTKVTLPAKPKHVELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKR    211 - 280
TNSSPRHTDIRGQRNTPASSKTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQNGVLVKETAIETKVTVSEE    281 - 350
EILPATRGMNGDSSENQALGPQPNQDDKADVQTDAGCLSEPVASALIPVKDHKLLEKEDSEAADSKSLVL    351 - 420
ENVTDTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPGPSLSLSAPAPGDVPKDTCVQSPISSFP    421 - 490
CTDLKVSENHKGCVLPVSRQNNEKMPLLELGGETTPPLSTERSPEAVGSECPSRVLVQVRSFVLPVESTQ    491 - 560
DVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPPQEEVLGNEHSHCTAELAAKSGPQVIPPASEKTL    561 - 630
PIQAQSQGSRTPLMAESSPTNSPSSGNHLATPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDMEKF    631 - 700
TEIIKQMDSAVCMPMKRKKARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLM    701 - 770
QNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDVTNGGIKRSRLEKSALFSSLLS    771 - 840
SLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQSNLLPDNSLKVFNFNSSS    841 - 910
TSHSSLKSPSHMEKYPQKEKTKEDLDSRSNLHLPETKFSELSKLKNDDMEKANHIESVIKSNLPNCANSD    911 - 980
TDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS    981 - 1050
LSPVILIKVVRGCWILYEQPNFEGHSIPLEEGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQDY   1051 - 1120
RVSHIDLFTEPEGLGILSSYFDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLS   1121 - 1190
FWDTEEAYIGSMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETGMCSFVMEGGETEEATGDDHLPF   1191 - 1260
TSVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILGDFSNAHMIMYSEKNFG   1261 - 1330
SKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYILDKGFYTSFEDWGGKNCKISSV   1331 - 1400
QPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVL   1401 - 1470
EEGHYPCLSAMGCPPGATFKSLRFIDVEFSEPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSVQV   1471 - 1540
IGGIWVTYEYGSYRGRQFLLSPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDL   1541 - 1610
KLLRIQVMEDVGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIY   1611 - 1680
SKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEAMVLYT                              1681 - 1723
//

Text Mined References (27)

PMID Year Title