Property Summary

NCBI Gene PubMed Count 169
PubMed Score 43.94
PubTator Score 112.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 1.9e-06
pancreatic ductal adenocarcinoma liver m... -2.478 6.5e-04
lung cancer 1.100 1.1e-03
lung adenocarcinoma 1.247 1.9e-08

Protein-protein Interaction (8)

Gene RIF (97)

PMID Text
26920061 strongly support a direct relationship between AIF nuclear translocation and radiation induced cell death in hepatocellular carcinoma cell line HepG2
26415504 Results identify PTEN as the substrate of AIF oxidoreductase and reveal a novel function for AIF in controlling tumor metastasis.
26237213 Residues Regulating the Reductase Activity of the Human Mitochondrial Apoptosis Inducing Factor
26206088 Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to truncated AIF mediated neuronal cell death progression following neurotoxic stimuli.
26165468 AIF bears a HSP-70 binding domain allowing association with HSP-70.
26119781 identification of the novel interaction between Trx1 and AIF has provided opportunities to design and develop therapeutically relevant strategies that either promote or prevent this protein-protein interaction for the treatment of different disease
26063804 AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type).
26012840 UDA decreased the St-induced changes in mitochondrial and cytosolic AIF level, whereas in Dox-model it affected only the cytosolic AIF content.
26004228 Data indicate that poptosis-inducing factor (AIF) controls the mitochondrial import of mitochondrial membrane transport protein CHCHD4.
25986071 Missense mutations in AIFM1 are associated with X-linked recessive auditory neuropathy spectrum disorder.
25583628 Summarizing what is known today, mutations in AIFM1 are associated with a progressive disorder with myopathy, ataxia and neuropathy.
24992339 These results suggest that AIF downregulation is a common event in kidney tumor development. AIF loss may lead to decreased STK3 activity, defective apoptosis and malignant transformation
24914854 both the mitochondrial and apoptotic functions of hAIF are interconnected and coenzyme controlled: a key information in the understanding of the physiological role of AIF in the cellular life and death cycle.
24889240 The E1B-55K or E4orf3 proteins independently prevented nuclear fragmentation subsequent to release of AIF from the mitochondria, possibly by altering the intracellular distribution of PAR-modified proteins.
24832602 beta-lapachone induces programmed necrosis through the NQO1-dependent ROS-mediated RIP1-PARP1-AIF pathway.
24684389 review describes the multistep course of parthanatos and its dependence on PAR signalling and nuclear AIF translocation.
24434516 Inhibition of the AIF/CypA complex protects against intrinsic death pathways induced by oxidative stress.
24434313 Aif seems to have pro-apoptotic and anti-apoptotic roles in the same lineage in different contexts and at different stages
24413738 Increased trophoblast apoptosis and altered expression levels of syncytin-1, calpain 1, and AIF is observed in preeclamptic placentas.
24247248 The diarylheptanoid hirsutenone sensitizes chemoresistant ovarian cancer cells to cisplatin via modulation of apoptosis-inducing factor and X-linked inhibitor of apoptosis.
24040019 Data show that buthionine sulfoximine and synergizes with hydroxychavicol in inducing apoptosis of chronic myeloid leukemic (CML) cells through the GSH-ROS-JNK-ERK-iNOS pathway by apoptosis inducing factor (AIF)-dependent manner.
23955799 Bit1 plays pivotal roles in the development and progression of ESCC, and its biological functions in ESCC may be closely associated with AIF and Bcl-2 levels.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages
23682427 AIF knockdown disrupts function of complex I and therefore increases the superoxide production in mitochondria
23673989 Apoptosis-inducing factor and leukocyte elastase inhibitor derived DNase II interact and can cooperate to induce cell death.
23515028 Calpain activation via Ca(2) flux plays an essential role in eliciting an AIF-mediated, caspase-independent apoptotic pathway in EV71-infected cells.
23443329 the caspase-independent mitochondrial apoptosis factor, apoptosis-inducing factor (AIF) was upregulated following SPG treatment. These findings indicate that SPG exerts its anticancer effects on RC-58T/h/SA#4 primary prostate cancer cells
23217327 Our findings expand the spectrum of AIF-related disease and provide insight into the effects of AIFM1 mutations.
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages
23118229 AIF is an important factor for advanced prostate cancer cells and that through control of energy metabolism and redox balance, the enzymatic activity of AIF is critical for this support.
23077592 our results suggest an essential role for AIF and its binding partner Scythe in the pathway leading to apoptotic corpse clearance.
22839996 Silencing of Apoptosis-Inducing factor and poly(ADP-ribose) glycohydrolase reveals novel roles in breast cancer cell death after chemotherapy.
22688575 Taken together our results demonstrate that parthenolide causes in the two cell lines a caspase-independent cell death, which is mediated by AIF(apoptosis-inducing factor ).
22438963 Confocal microscopy showed that TWEAK induces the cleavage and the translocation of apoptosis inducing factor (AIF) from the mitochondria to the nucleus, thus initiating caspase-independent apoptosis.
22371500 Our data demonstrate that SIP is a novel regulator in caspase-independent and AIF-mediated apoptosis.
22328780 Different mechanisms preserve translation of programmed cell death 8 and JunB in poliovirus-infected endothelial cells.
22134679 AIF is imported from the endoplasmic reticulum to the mitochondria via mitochondria-associated membranes and transport vesicles.
22133578 We found AIF to be strongly expressed in the villous trophoblast and that small amounts of AIF were localized to the nucleus of the cells.
22019070 in the second report of a mutation in the AIFM1 gene, we extend the clinical spectrum to include prenatal ventriculomegaly, underscoring the importance of AIF for complex I assembly
21732781 AIF was strongly and diffusely expressed in 19/23 cases of diffuse large b-cell lymphoma and weakly positive in 15/20 cases of small lymphocytic lymphoma.
21616126 Low AIF-expressing Harlequin mutant mice are subjected to 10 min of global cerebral ischemia causing nuclear translocation of AIF, nuclear pyknosis, and DNA fragmentation.
21293491 Data indicate that CHIP and USP2 show antagonistic functions in the control of AIF-mediated cell death, and implicate the role of the enzymes as a switch for cells to live or die under stresses that cause truncated AIF release.
21206973 Benzyl isothiocyanate induces apoptosis in DU 145 cells through the release of AIF and Endo G from the mitochondria and also promotes caspase-3 activation.
21075090 The AIF-mediated mitochondrial pathway plays a critical role in the protective effect of diazoxide against SH-SY5Y cell apoptosis induced by oxygen-glucose deprivation.
20974255 AIF deficiency leads to altered mitochondrial fusion and caspase-dependent cerebellar Purkinje cell loss in transgenic Harlequin mice.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20450942 Homocysteine and copper induce not only caspase-dependent apoptosis but also caspase-independent apoptosis-inducing factor related apoptosis.
20450583 AIF activation and translocation to nuclei mediates cisplatin-induced apoptosis of renal tubular epithelial cells in vitro.
20362274 AIFM1 mutation is associated with severe X-linked mitochondrial encephalomyopathy.
20228227 apoptosis-inducing factor-mediated caspase-independent neuronal death has a role in Alzheimer disease
20177052 Poly(ADP-ribose) polymerase (PARP)-1-independent apoptosis-inducing factor (AIF) release and cell death are induced by eleostearic acid and blocked by alpha-tocopherol and MEK inhibition.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19781850 nuclear translocation of apoptosis-inducing factor and endonuclease G play a crucial role in (-)-Epigallocatechin-3-gallate -induced apoptosis of human laryngeal epidermoid carcinoma Hep2 cells
19723032 Data show that in cells with fragmented chromatin (i.e., in late apoptosis), the immunolabeling for AIF appeared to be distinct from chromatin, being mainly confined to mitochondria.
19723031 Studies showed the manifold roles of AIF in cell life and death.
19669652 Our results provide evidence for persistent cleavage and nuclear translocation of AIF in amyotrophic lateral sclerosis spinal cord, suggesting implications for the AIF-mediated motor neuron death in this disease.
19598027 The positive rates of AIF and caspase-3 in colorectal adenoma were higher than those in normal mucosa. The positive rate of AIF in adenoma showed no significant difference compared to colorectal carcinoma.
19578750 TAp63gamma could induce apoptosis in human esophageal squamous cancer EC9706 cells, through at least releasing AIF and Bit1 from mitochindria into cytosol and nucleus, where apoptotic cascade takes place.
19418225 These findings suggest that an acute energy reduction by H(2)O(2) causes caspase-independent and AIF-dependent cell death.
19197367 AIF is essential for maintaining beta-cell mass and for oxidative stress response.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18821579 AIF translocation has a role in FK228-induced autophagy in malignant rhabdoid tumor cells
18806756 These results provide novel insights into the mechanism of AIF release during cell death.
18593521 Promoting neuronal survival of GDNF might be related to the reduction of AIF nuclear translocation, indicating the high therapeutic potency of SeV/GDNF for cerebral ischemia.
18306460 Hibiscus syriacus extract exhibits a cytotoxic effect on lung cancer cells by activation p53 and AIF.
18056262 Scythe regulates apoptosis-inducing factor stability during endoplasmic reticulum stress-induced apoptosis
17822623 Down-regulation of apoptosis inducing factor inhibits TAp63gamma-induced apoptosis.
17709377 TULA enhances the apoptotic effect of AIF by facilitating the interactions of AIF with its apoptotic co-factors
17603079 Inhibitor of apoptosis proteins, nuclear factor-kappa, Smac/DIABLO and apoptosis inducing factor were increased in colon cancer cells.
17560018 AIF is associated with cisplatin induced apoptosis in prostate cancer
17492772 Data suggest that erythroblast chromatin degradation may involve caspase activated DNase and apoptosis inducing factor, enzymes distinct from those active in apoptotic cells.
17471535 PKB/Akt inhibits ceramide-induced apoptosis in neuroblastoma cells by blocking AIF translocation.
17352692 Down-regulation of hSUV3 results in cell cycle perturbations and in apoptosis, which is both AIF- and caspase-dependent, and proceeds with the induction of p53.
17347867 study of cellular localization of the endonuclease G, AIF & AMID during apoptosis using bioinformatics and image analysis
17107772 Hypochlorous acid induced Bax-dependent mitochondrial permeability which led to cell death without caspase activity by processes involving AIF/EndoG-dependent pathways.
17094969 AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein
16729031 Moreover, in the absence of overt apoptotic signals, the constitutive induction of AIF by p53 may underpin a cytoprotective maintenance role, based on the role of AIF in ensuring proper mitochondrial function.
16644725 the cloning and the biochemical characterization of a new isoform named AIF short 2 (AIFsh2)
16628003 AIF-mediated cell death is regulated by the functional interplay of SIRT1 and PARP-1 in response to DNA damage
16511342 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages
16365034 AIF short (AIFsh), a new pro-apoptotic isoform of AIF, reveals that the first N-terminal 352 amino acids of AIF are not required for its apoptotic activity.
16049016 AIF is responsible for stage I nuclear morphology and HMW DNA degradation is a caspase-activated DNase and AIF-independent process
15729291 findings indicate that PARP-1 activation and a PARP-1-dependent, caspase-independent, nuclear translocation of AIF contribute to apoptotic cerebral endothelial cell death after ischemia-reperfusion
15703386 AIF is involved in NMDA- and kainic acid- but not AMPA-induced excitotoxicity. AIF plays an important role in both BAX-dependent and BAX-independent mechanisms of neuronal injury.
15526035 AIF plays a role in oxidative phosphorylation
15316071 The oxidoreductase function of AIF is required for the maintenance of glutathione levels in stress conditions and that glutathione is a major regulator of SG.
15286713 suggests a role in mitochondrial-mediated death pathway
15182854 endonuclease G and apoptosis-inducing factor are relocated and have roles in calcium induced signaling and oxidative stress-related impairment of mitochondria
15033690 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages
14716299 AIF and CYPA cooperate in apoptosis-associated chromatinolysis.
14585540 AIF is not implicated in CD47-dependent cell death of T cells
12668724 apoptosis-inducing factor has a role in oxidant-induced cell death in retinal pigment epithelium cells
12629154 Possible contribution of apoptosis-inducing factor and reactive oxygen species to UVB-induced caspase-independent cell death in the T cell
12535654 These data suggest that apoptosis-inducing factor (AIF) is expressed in human coronary artery endothelial cells (HCAECs) and is upregulated by oxidized low density lipoproteins.
12404120 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages
12198487 observations suggest that AIF-induced nuclear apoptosis requires a direct interaction with DNA
11193032 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of apoptosis-inducing factor 1 (AIFM1, PDCD8, mitochondrial) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLV      1 - 70
LIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGG     71 - 140
TAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSF    141 - 210
YVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSR    211 - 280
TTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSN    281 - 350
WTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG    351 - 420
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDV    421 - 490
GYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDY    491 - 560
GKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED                     561 - 613
//

Text Mined References (177)

PMID Year Title
26920061 2016 Caspase-independent cell death mediated by apoptosis-inducing factor (AIF) nuclear translocation is involved in ionizing radiation induced HepG2 cell death.
26415504 2015 AIF inhibits tumor metastasis by protecting PTEN from oxidation.
26313918 2015 The novel protective role of P27 in MLN4924-treated gastric cancer cells.
26313915 2015 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26304929 2015 Targeting activating mutations of EZH2 leads to potent cell growth inhibition in human melanoma by derepression of tumor suppressor genes.
26293804 2016 TPGS/Phospholipids Mixed Micelles for Delivery of Icariside II to Multidrug-Resistant Breast Cancer.
26259540 2015 Heart mitochondria and calpain 1: Location, function, and targets.
26258875 2016 FV-429 induces apoptosis and inhibits glycolysis by inhibiting Akt-mediated phosphorylation of hexokinase II in MDA-MB-231 cells.
26252009 2015 Embelin-Induced Apoptosis of Human Prostate Cancer Cells Is Mediated through Modulation of Akt and ?-Catenin Signaling.
26237213 2015 Key Residues Regulating the Reductase Activity of the Human Mitochondrial Apoptosis Inducing Factor.
26231658 2015 Induction of reactive oxygen species-mediated apoptosis by purified Schisandrae semen essential oil in human leukemia U937 cells through activation of the caspase cascades and nuclear relocation of mitochondrial apoptogenic factors.
26206088 2016 Phosphorylation of CHIP at Ser20 by Cdk5 promotes tAIF-mediated neuronal death.
26204398 2015 Changes in cell death of peripheral blood lymphocytes isolated from children with acute lymphoblastic leukemia upon stimulation with 7 Hz, 30 mT pulsed electromagnetic field.
26197224 2015 Neuroprotective effect of astaxanthin against glutamate-induced cytotoxicity in HT22 cells: Involvement of the Akt/GSK-3? pathway.
26188334 2015 Mitochondrial 2', 3'-cyclic nucleotide 3'-phosphodiesterase (CNP) interacts with mPTP modulators and functional complexes (I-V) coupled with release of apoptotic factors.
26173962 2016 A novel AIFM1 mutation expands the phenotype to an infantile motor neuron disease.
26165468 2015 Heat shock protein-70 neutralizes apoptosis inducing factor in Bcr/Abl expressing cells.
26164795 2015 III-10, a newly synthesized flavonoid, induces cell apoptosis with the involvement of reactive oxygen species-mitochondria pathway in human hepatocellular carcinoma cells.
26158520 2015 Loss of apoptosis-inducing factor critically affects MIA40 function.
26148186 2015 A Potent Inhibitor of Phosphoinositide 3-Kinase (PI3K) and Mitogen Activated Protein (MAP) Kinase Signalling, Quercetin (3, 3', 4', 5, 7-Pentahydroxyflavone) Promotes Cell Death in Ultraviolet (UV)-B-Irradiated B16F10 Melanoma Cells.
26137088 2015 Artesunate-enhanced apoptosis of human high-risk myelodysplastic cells induced by the DNA methyltransferase inhibitor decitabine.
26122529 2016 Crude extract of Euphorbia formosana induces apoptosis of DU145 human prostate cancer cells acts through the caspase-dependent and independent signaling pathway.
26119781 2015 Thioredoxin-dependent regulation of AIF-mediated DNA damage.
26112407 2015 Phosphatidylinositol Induces Caspase-Independent Apoptosis of Malignant Pleural Mesothelioma Cells by Accumulating AIF in the Nucleus.
26074733 2015 Growth inhibitory and chemo-sensitization effects of naringenin, a natural flavanone purified from Thymus vulgaris, on human breast and colorectal cancer.
26066050 2015 Heat Shock Protein 70 Prevents Hyperoxia-Induced Disruption of Lung Endothelial Barrier via Caspase-Dependent and AIF-Dependent Pathways.
26063804 2015 Apoptosis-inducing Factor (AIF) and Its Family Member Protein, AMID, Are Rotenone-sensitive NADH:Ubiquinone Oxidoreductases (NDH-2).
26044191 2015 NVP-BKM120 potentiates apoptosis in tumor necrosis factor-related apoptosis-inducing ligand-resistant glioma cell lines via upregulation of Noxa and death receptor 5.
26042464 2015 Induction of Apoptosis in Endometrial Cancer (Ishikawa) Cells by Pogostemon cablin Aqueous Extract (PCAE).
26035067 2015 Protective effect of hydrogen-rich medium against high glucose-induced apoptosis of Schwann cells in vitro.
26027833 2015 Anti-apoptotic and Beneficial Metabolic Activities of Resveratrol in Type II Gaucher Disease.
26012840 2015 An Involvement of PI3-K/Akt Activation and Inhibition of AIF Translocation in Neuroprotective Effects of Undecylenic Acid (UDA) Against Pro-Apoptotic Factors-Induced Cell Death in Human Neuroblastoma SH-SY5Y Cells.
26004228 2015 Interaction between AIF and CHCHD4 Regulates Respiratory Chain Biogenesis.
25998745 2015 Daintain/AIF-1 accelerates the activation of insulin-like growth factor-1 receptor signaling pathway in HepG2 cells.
25986071 2015 Mutations in apoptosis-inducing factor cause X-linked recessive auditory neuropathy spectrum disorder.
25976678 2015 Cambogin Induces Caspase-Independent Apoptosis through the ROS/JNK Pathway and Epigenetic Regulation in Breast Cancer Cells.
25976011 2015 Mitochondrial modulators in experimental Huntington's disease: reversal of mitochondrial dysfunctions and cognitive deficits.
25972151 2015 Hesperetin Induces the Apoptosis of Gastric Cancer Cells via Activating Mitochondrial Pathway by Increasing Reactive Oxygen Species.
25954805 2015 Correction: Deletion of the Mitochondrial Flavoprotein Apoptosis Inducing Factor (AIF) Induces ?-Cell Apoptosis and Impairs ?-Cell Mass.
25949267 2015 Xanthohumol induces growth inhibition and apoptosis in ca ski human cervical cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25943027 2015 Salvianolic acid A attenuates TNF-?- and D-GalN-induced ER stress-mediated and mitochondrial-dependent apoptosis by modulating Bax/Bcl-2 ratio and calcium release in hepatocyte LO2 cells.
25937300 2015 Nelfinavir, an HIV protease inhibitor, induces apoptosis and cell cycle arrest in human cervical cancer cells via the ROS-dependent mitochondrial pathway.
25934856 2015 A slowly progressive mitochondrial encephalomyopathy widens the spectrum of AIFM1 disorders.
25909282 2015 Synergistic protection of N-acetylcysteine and ascorbic acid 2-phosphate on human mesenchymal stem cells against mitoptosis, necroptosis and apoptosis.
25885900 2015 Annonaceous acetogenin mimic AA005 induces cancer cell death via apoptosis inducing factor through a caspase-3-independent mechanism.
25874633 2015 Calpain inhibitor PD150606 attenuates glutamate induced spiral ganglion neuron apoptosis through apoptosis inducing factor pathway in vitro.
25868101 2015 Apoptosis in human compressive myelopathy due to metastatic neoplasia.
25813094 2015 Demethoxycurcumin induces the apoptosis of human lung cancer NCI-H460 cells through the mitochondrial-dependent pathway.
25799586 2015 Dihydroartemisinin inhibits glucose uptake and cooperates with glycolysis inhibitor to induce apoptosis in non-small cell lung carcinoma cells.
25758767 2015 Defects in calcium homeostasis and mitochondria can be reversed in Pompe disease.
25661514 2015 Neuroprotective effects of mGluR II and III activators against staurosporine- and doxorubicin-induced cellular injury in SH-SY5Y cells: New evidence for a mechanism involving inhibition of AIF translocation.
25583628 2015 From ventriculomegaly to severe muscular atrophy: expansion of the clinical spectrum related to mutations in AIFM1.
25561728 2015 Mechanism-based proteomic screening identifies targets of thioredoxin-like proteins.
25549939 2015 Cystamine induces AIF-mediated apoptosis through glutathione depletion.
25486353 2014 Novel insights into the mitochondrial permeability transition.
25294638 2015 Withania somnifera Improves Ischemic Stroke Outcomes by Attenuating PARP1-AIF-Mediated Caspase-Independent Apoptosis.
25283819 2014 Mitochondrial apoptosis-inducing factor is involved in doxorubicin-induced toxicity on H9c2 cardiomyoblasts.
25280774 2015 17-beta estradiol inhibits oxidative stress-induced accumulation of AIF into nucleolus and PARP1-dependent cell death via estrogen receptor alpha.
25246086 2014 Upregulation of Atg5 and AIF gene expression in synchronization with programmed cellular death events in integumental epithelium of Bombyx mori induced by a dipteran parasitoid infection.
25110935 2014 Recent advances in Charcot-Marie-Tooth disease.
25048111 2015 PPAR? activation attenuates amyloid-?-dependent neurodegeneration by modulating Endo G and AIF translocation.
24992339 2014 AIF downregulation and its interaction with STK3 in renal cell carcinoma.
24914854 2014 Structural insights into the coenzyme mediated monomer-dimer transition of the pro-apoptotic apoptosis inducing factor.
24889240 2014 E1B and E4 oncoproteins of adenovirus antagonize the effect of apoptosis inducing factor.
24884644 2014 Calpain: a molecule to induce AIF-mediated necroptosis in RGC-5 following elevated hydrostatic pressure.
24832602 2014 ?-Lapachone induces programmed necrosis through the RIP1-PARP-AIF-dependent pathway in human hepatocellular carcinoma SK-Hep1 cells.
24684389 2014 Parthanatos: mitochondrial-linked mechanisms and therapeutic opportunities.
24628719 2014 Matrine induces caspase-independent program cell death in hepatocellular carcinoma through bid-mediated nuclear translocation of apoptosis inducing factor.
24607566 2014 Modulation of calcium-induced cell death in human neural stem cells by the novel peptidylarginine deiminase-AIF pathway.
24511002 2014 Myricetin induces cell death of human colon cancer cells via BAX/BCL2-dependent pathway.
24434516 2014 Inhibition of the AIF/CypA complex protects against intrinsic death pathways induced by oxidative stress.
24434313 2013 Role of apoptosis-inducing factor (Aif) in the T cell lineage.
24413738 2014 Reduced syncytin-1 expression in choriocarcinoma BeWo cells activates the calpain1-AIF-mediated apoptosis, implication for preeclampsia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247248 2014 The diarylheptanoid hirsutenone sensitizes chemoresistant ovarian cancer cells to cisplatin via modulation of apoptosis-inducing factor and X-linked inhibitor of apoptosis.
24040019 2013 Synergistic apoptosis of CML cells by buthionine sulfoximine and hydroxychavicol correlates with activation of AIF and GSH-ROS-JNK-ERK-iNOS pathway.
23955799 2014 Implications of Bit1 and AIF overexpressions in esophageal squamous cell carcinoma.
23682427 2012 Knockdown of apoptosis-inducing factor disrupts function of respiratory complex I.
23673989 2013 Apoptosis-inducing factor (AIF) and leukocyte elastase inhibitor/L-DNase II (LEI/LDNaseII), can interact to conduct caspase-independent cell death.
23515028 2013 Calcium flux and calpain-mediated activation of the apoptosis-inducing factor contribute to enterovirus 71-induced apoptosis.
23443329 2013 Crude saponins from Platycodon grandiflorum induce apoptotic cell death in RC-58T/h/SA#4 prostate cancer cells through the activation of caspase cascades and apoptosis-inducing factor.
23217327 2012 Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118229 2012 The enzymatic activity of apoptosis-inducing factor supports energy metabolism benefiting the growth and invasiveness of advanced prostate cancer cells.
23077592 2012 AIF and Scythe (Bat3) regulate phosphatidylserine exposure and macrophage clearance of cells undergoing Fas (APO-1)-mediated apoptosis.
22839996 2012 Silencing of Apoptosis-Inducing factor and poly(ADP-ribose) glycohydrolase reveals novel roles in breast cancer cell death after chemotherapy.
22688575 2013 Parthenolide induces caspase-independent and AIF-mediated cell death in human osteosarcoma and melanoma cells.
22438963 2012 TWEAK affects keratinocyte G2/M growth arrest and induces apoptosis through the translocation of the AIF protein to the nucleus.
22371500 2012 Steroid receptor coactivator-interacting protein (SIP) inhibits caspase-independent apoptosis by preventing apoptosis-inducing factor (AIF) from being released from mitochondria.
22328780 2012 Different mechanisms preserve translation of programmed cell death 8 and JunB in virus-infected endothelial cells.
22134679 2012 An alternative import pathway of AIF to the mitochondria.
22133578 2012 The contribution of apoptosis-inducing factor (AIF) to villous trophoblast differentiation.
22103349 2011 Nondegradative ubiquitination of apoptosis inducing factor (AIF) by X-linked inhibitor of apoptosis at a residue critical for AIF-mediated chromatin degradation.
22019070 2011 Early prenatal ventriculomegaly due to an AIFM1 mutation identified by linkage analysis and whole exome sequencing.
21732781 2011 Expression of AIF and HtrA2/Omi in small lymphocytic lymphoma and diffuse large B-cell lymphoma.
21616126 2011 Role of apoptosis inducing factor (AIF) for hippocampal neuronal cell death following global cerebral ischemia in mice.
21364629 2010 Vital function of PRELI and essential requirement of its LEA motif.
21293491 2011 Control of AIF-mediated cell death by antagonistic functions of CHIP ubiquitin E3 ligase and USP2 deubiquitinating enzyme.
21269460 2011 Initial characterization of the human central proteome.
21206973 2011 The roles of AIF and Endo G in the apoptotic effects of benzyl isothiocyanate on DU 145 human prostate cancer cells via the mitochondrial signaling pathway.
21075090 2011 AIF-mediated mitochondrial pathway is critical for the protective effect of diazoxide against SH-SY5Y cell apoptosis.
20974255 2011 Apoptosis inducing factor deficiency causes reduced mitofusion 1 expression and patterned Purkinje cell degeneration.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20450942 2010 Homocysteine and copper induce cellular apoptosis via caspase activation and nuclear translocation of apoptosis-inducing factor in neuronal cell line SH-SY5Y.
20450583 2010 [Apoptosis inducing factor mediates cisplatin-induced apoptosis of renal tubular epithelial cells].
20362274 2010 Severe X-linked mitochondrial encephalomyopathy associated with a mutation in apoptosis-inducing factor.
20228227 2010 Evidence for the involvement of apoptosis-inducing factor-mediated caspase-independent neuronal death in Alzheimer disease.
20177052 2010 Poly(ADP-ribose) polymerase (PARP)-1-independent apoptosis-inducing factor (AIF) release and cell death are induced by eleostearic acid and blocked by alpha-tocopherol and MEK inhibition.
20111043 2010 A brain-specific isoform of mitochondrial apoptosis-inducing factor: AIF2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19781850 2010 EGCG induces apoptosis in human laryngeal epidermoid carcinoma Hep2 cells via mitochondria with the release of apoptosis-inducing factor and endonuclease G.
19723032 2009 Changes of mitochondria and relocation of the apoptosis-inducing factor during apoptosis.
19723031 2009 AIF: not just an apoptosis-inducing factor.
19669652 2009 Persistent cleavage and nuclear translocation of apoptosis-inducing factor in motor neurons in the spinal cord of sporadic amyotrophic lateral sclerosis patients.
19598027 2009 [Expression of AIF and caspase-3 in colorectal carcinoma, adenoma, and normal mucosa and its correlation].
19578750 2009 Down-regulation of the apoptosis-inducing factor or Bcl-2 inhibitor of transcription by RNA interference can alleviate TAp63gamma-induced apoptosis in esophageal squamous carcinoma EC9706 cells.
19418225 2009 Apoptosis-inducing factor plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells.
19197367 2009 Deletion of the mitochondrial flavoprotein apoptosis inducing factor (AIF) induces beta-cell apoptosis and impairs beta-cell mass.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18821579 2009 Induction of autophagy in malignant rhabdoid tumor cells by the histone deacetylase inhibitor FK228 through AIF translocation.
18806756 2008 An increase in intracellular Ca2+ is required for the activation of mitochondrial calpain to release AIF during cell death.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593521 2008 Sendai virus-mediated gene transfer of GDNF reduces AIF translocation and ameliorates ischemic cerebral injury.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18306460 2008 The extract of Hibiscus syriacus inducing apoptosis by activating p53 and AIF in human lung cancer cells.
18056262 2008 Scythe regulates apoptosis-inducing factor stability during endoplasmic reticulum stress-induced apoptosis.
17967870 2008 Apoptosis-inducing factor is a target for ubiquitination through interaction with XIAP.
17822623 2007 [TAp63gamma-induced apoptosis mediated by apoptosis inducing factor in human esophageal squamous carcinoma EC9706 cells].
17709377 2007 T-cell ubiquitin ligand affects cell death through a functional interaction with apoptosis-inducing factor, a key factor of caspase-independent apoptosis.
17603079 2007 Modification of gene products involved in resistance to apoptosis in metastatic colon cancer cells: roles of Fas, Apaf-1, NFkappaB, IAPs, Smac/DIABLO, and AIF.
17560018 2007 Nuclear translocation of apoptosis inducing factor is associated with cisplatin induced apoptosis in LNCaP prostate cancer cells.
17492772 2007 The chromatin of differentiating erythroblasts is cleaved into large size fragments independent of caspase activated DNase and apoptosis inducing factor.
17471535 2007 PKB/Akt inhibits ceramide-induced apoptosis in neuroblastoma cells by blocking apoptosis-inducing factor (AIF) translocation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17352692 2007 Down-regulation of human RNA/DNA helicase SUV3 induces apoptosis by a caspase- and AIF-dependent pathway.
17347867 2007 Bioinformatic and image analyses of the cellular localization of the apoptotic proteins endonuclease G, AIF, and AMID during apoptosis in human cells.
17107772 2007 The pro-inflammatory oxidant hypochlorous acid induces Bax-dependent mitochondrial permeabilisation and cell death through AIF-/EndoG-dependent pathways.
17094969 2006 Apoptosis-inducing factor (AIF) inhibits protein synthesis by interacting with the eukaryotic translation initiation factor 3 subunit p44 (eIF3g).
16729031 2006 Regulation of AIF expression by p53.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16644725 2006 Identification and characterization of AIFsh2, a mitochondrial apoptosis-inducing factor (AIF) isoform with NADH oxidase activity.
16628003 2006 Control of AIF-mediated cell death by the functional interplay of SIRT1 and PARP-1 in response to DNA damage.
16365034 2006 AIFsh, a novel apoptosis-inducing factor (AIF) pro-apoptotic isoform with potential pathological relevance in human cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16049016 2005 The contribution of apoptosis-inducing factor, caspase-activated DNase, and inhibitor of caspase-activated DNase to the nuclear phenotype and DNA degradation during apoptosis.
15775970 2005 Export of mitochondrial AIF in response to proapoptotic stimuli depends on processing at the intermembrane space.
15772651 2005 The DNA sequence of the human X chromosome.
15729291 2005 Cerebral endothelial cell apoptosis after ischemia-reperfusion: role of PARP activation and AIF translocation.
15703386 2005 Apoptosis-inducing factor is a key factor in neuronal cell death propagated by BAX-dependent and BAX-independent mechanisms.
15526035 2004 AIF deficiency compromises oxidative phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316071 2004 Regulation of cytoplasmic stress granules by apoptosis-inducing factor.
15286713 2004 Apoptosis-inducing factor determines the chemoresistance of non-small-cell lung carcinomas.
15182854 2004 Cadmium induces caspase-independent apoptosis in liver Hep3B cells: role for calcium in signaling oxidative stress-related impairment of mitochondria and relocation of endonuclease G and apoptosis-inducing factor.
14716299 2004 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585540 2003 Mitochondrial dysfunction in CD47-mediated caspase-independent cell death: ROS production in the absence of cytochrome c and AIF release.
12930708 2003 HSP72 inhibits apoptosis-inducing factor release in ATP-depleted renal epithelial cells.
12668724 2003 Oxidant-induced cell death in retinal pigment epithelium cells mediated through the release of apoptosis-inducing factor.
12629154 2003 Possible contribution of apoptosis-inducing factor (AIF) and reactive oxygen species (ROS) to UVB-induced caspase-independent cell death in the T cell line Jurkat.
12535654 2003 Identification of apoptosis-inducing factor in human coronary artery endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198487 2002 DNA binding is required for the apoptogenic action of apoptosis inducing factor.
12022952 Apoptosis-inducing factor (AIF): a novel caspase-independent death effector released from mitochondria.
11533664 2001 Heat-shock protein 70 antagonizes apoptosis-inducing factor.
11279485 2001 Essential role of the mitochondrial apoptosis-inducing factor in programmed cell death.
10913597 2000 Apoptosis-inducing factor (AIF): a ubiquitous mitochondrial oxidoreductase involved in apoptosis.
10744629 2000 Mitochondrio-nuclear translocation of AIF in apoptosis and necrosis.
9989411 1999 Molecular characterization of mitochondrial apoptosis-inducing factor.
9892620 1999 Mitochondrial release of caspase-2 and -9 during the apoptotic process.
9206994 1997 The central executioner of apoptosis: multiple connections between protease activation and mitochondria in Fas/APO-1/CD95- and ceramide-induced apoptosis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
1202295 1975 Classification of biological networks by their qualitative dynamics.