Property Summary

NCBI Gene PubMed Count 75
PubMed Score 562.88
PubTator Score 231.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 6.9e-03
psoriasis -1.800 6.7e-04
osteosarcoma -2.443 1.4e-04
chronic lymphosyte leukemia -1.300 6.4e-09
glioblastoma 2.100 1.4e-03
group 3 medulloblastoma -1.400 5.8e-03
medulloblastoma, large-cell -1.400 1.0e-02
adrenocortical carcinoma -1.793 4.0e-04
tuberculosis 2.800 6.9e-10
non-small cell lung cancer -1.359 5.1e-12
intraductal papillary-mucinous adenoma (... -1.500 3.6e-04
intraductal papillary-mucinous carcinoma... -1.600 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.9e-03
lung cancer -2.500 6.3e-06
interstitial cystitis 1.700 6.4e-04
pilocytic astrocytoma 1.400 1.1e-05
Pneumonia -1.100 2.3e-02
subependymal giant cell astrocytoma 1.940 1.4e-02
invasive ductal carcinoma 1.106 4.2e-04
lung adenocarcinoma -1.109 8.5e-05
lung carcinoma -1.800 4.0e-20
ulcerative colitis 1.400 4.4e-05
ovarian cancer -2.100 1.1e-08
head and neck cancer and chronic obstruc... 1.200 1.6e-03

Gene RIF (53)

PMID Text
27442380 Using double labeling with Iba-1 and cd68 could determine the physiological state of microglia in brain contusion based on their morphology and immunoreactivity.
26585362 involved in the immunological process underlying rheumatoid arthritis
26324213 The results of our study suggest that the AIF1 gene polymorphisms have no influence on long-term kidney allograft function.
25998745 Data showed that AIF-1 promoted the proliferation of HepG2 cells by accelerating the activation of IGF-1R and its downstream signaling pathway, which confirms that AIF-1 plays a crucial role in the development of hepatocellular carcinoma cells.
25026748 The results of this study suggest a lack of association between AIF-1 gene polymorphisms and response to sulphasalazine treatment in rheumatoid arthritis.
24796669 AIF-1, which induced chemokines and enhanced chemotaxis of monocytes, may represent a molecular target for the therapy of immune-inflammatory disorders
24742347 HIV-1 and the viral protein Tat modulate the expression of allograft inflammatory factor 1 (AIF1) in immature dendritic cells and monocyte-derived macrophages
24337893 AIF-1 functions as a tumor suppressor possibly by regulating beta-catenin in gastric cancer. the level of AIF-1 expression may serve as a protective prognostic indicator for gastric cancer.
24018427 The results of this study suggest that the patients with the rs2259571 CC AIF1 genotype have a poorer response to therapy with Methotrexate.
23867161 The overexpressed AIF-1, the novel inflammatory polypeptide derived from macrophage lineages, is closely associated with atherogenesis via affecting the blood composition and promoting macrophage uptake and foam cell formation.
23777936 We are unable to find statistically significant association between COX-2 and AIF-1 gene polymorphisms and allograft survival.
23547889 AIF-1 can protect rheumatoid arthritis fibroblast-like synoviocytes from apoptosis induced by NO by upregulating the expression of p-Akt and p-BAD.
23221708 daintain/AIF-1 reinforced the resistance of breast cancer cells to cisplatin by inhibition of cell apoptosis and reduction of intracellular cisplatin accumulation
22560794 Serum AIF-1 concentration correlated with albuminuria and eGFR in patients with type 2 diabetes and it could be a marker of diabetic nephropathy as well as activated macrophages.
22225958 The serum AIF-1 concentrations were positively correlated with levels of fasting plasma glucose, hemoglobin A1c, triglycerides, and uric acid, and with waist circumference and BMI, and were inversely correlated with HDL cholesterol levels.
22116621 Overexpression of AIF-1 stimulates migration and proliferation of human vascular smooth muscle cells, whereas IRT-1 exerts opposite effects.
22106834 Our results suggest that the AIF1 rs2259571 CC genotype is associated with the active form of RA.
21720444 Our data suggest that SNPs in or near the AIF1 locus contribute to obesity risk in the Greek population.
21509525 daintain/AIF-1 activates p38 MAPK signaling pathway contributing to up-regulation of TNF-alpha in MDA-MB-231 and MCF-7 cells.
21168672 data demonstrated that expression profiles of AIF-1 and TLR-2 correlated with biopsy-proven allograft rejection in both peripheral blood and local tissue, suggesting their potential as diagnostic biomarkers for early detection of allograft rejection
21040744 AIF-1 can induce IL-6 secretion on mononuclear cells and fibroblast chemotaxis. AIF-1 may accordingly provide an attractive new target for antifibrotic therapy in SSc as well as Scl GVHD.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20850992 AIF-1 shows promise that it can be a potential biomarker for cardiac allograft rejection.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19745784 findings suggest that the impact of AIF-1 on endothelial cells would stimulate angiogenesis and consequently affect the progression of infantile hemangiomas
19204726 Observational study of gene-disease association. (HuGE Navigator)
18987644 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families
18987644 Observational study of gene-disease association. (HuGE Navigator)
18835879 Observational study of gene-disease association. (HuGE Navigator)
18816612 AIF-1 plays a role in inflammatory nerve disease and vascular smooth muscle cell proliferation and may be a new molecular target for treatment.
18787073 AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis.
18721278 The AIF1 rs2269475 T allele is associated with increased risk of rheumatoid arthritis development.
18721278 Observational study of gene-disease association. (HuGE Navigator)
18341653 daintain/AIF-1 can promote the growth of breast tumors via activating NF-kappaB signaling, which consequently up-regulates the expression of cyclin D1.
17907195 These results suggest that AIF-1 may participate in the early pathogenesis of systemic sclerosis by promoting tissue T cell infiltration and production of cytokines capable of inducing the expression of a fibrotic phenotype in normal fibroblasts.
17533487 Using immunohistochemistry, we found that AIF-1 is expressed at low levels in normal skin, but is highly upregulated in various inflammatory skin disorders
17522098 Observational study of gene-disease association. (HuGE Navigator)
17522098 a genetic association between AIF1 and the anti-centromere antibodies-positive subset of systemic sclerosis.
17498268 association of a nonsynonymous change within the AIF-1 gene with systemic sclerosis, and linkage with TNFA alleles within 50 kb of this gene
17073733 Crystals of AIF-1 were grown at 291 K using PEG-8000 as precipitant, and diffraction extends to 3.3 A resolution.
17035944 AIF-1 is a novel molecular component of podocytes and the upregulation of AIF-1 in an anti-GBM nephritis model may mainly be a consequence of its expression in infiltrating cells.
17011575 The molecular conformational change induced by Ca(2+)-binding of Iba1 is different from that found in the classical EF-hand proteins, which demonstrates that Iba1 has an unique molecular switching mechanism dependent on Ca(2+)-binding.
17010532 The subtle regulation of allograft inflammatory factor-1 in the involution of hemangiomas will help design a new anti-angiogenic therapy for some tumors. [REVIEW]
16291819 These data indicate that AIF-1 mediates atherogenesis-initiated signaling and activation of macrophages.
16049345 Overexpression of allograft inflammatory factor-1 is associated with development of coronary artery vasculopathy
15922740 The ability of AIF-1 to activate vascular smooth muscle is lost by mutation in the EF-hand calcium-binding region.
15784173 Genomic rearrangement of AIF1 in arteriosclerosis was studied.
15117732 AIF-1 enhances VSMC growth by autocrine production of G-CSF, and AIF-1 expression may influence VSMC-inflammatory cell communication.
12887599 more AIF-1 immunoreactive macrophages/microglial cells and, interestingly, neurones were observed in Creutzfeldt-Jakob disease patients
12714565 AIF-1 binds and polymerizes F actin and also regulates Rac1 activity and vascular smooth muscle migration
12559634 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSL      1 - 70
KRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAK     71 - 140
KAISELP                                                                   141 - 147
//

Text Mined References (79)

PMID Year Title
27442380 2015 Visualisation of Microglia with the use of Immunohistochemical Double Staining Method for CD-68 and Iba-1 of Cerebral Tissue Samples in Cases of Brain Contusions.
26585362 2016 Expression of allograft inflammatory factor-1 in peripheral blood monocytes and synovial membranes in patients with rheumatoid arthritis.
26324213 2015 Influence of AIF1 Gene Polymorphisms on Long-Term Kidney Allograft Function.
25998745 2015 Daintain/AIF-1 accelerates the activation of insulin-like growth factor-1 receptor signaling pathway in HepG2 cells.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
25026748 2013 [Association between AIF-1 gene polymorphisms and response to rheumatoid arthritis treatment with sulphasalazine].
24796669 2014 Allograft inflammatory factor-1 stimulates chemokine production and induces chemotaxis in human peripheral blood mononuclear cells.
24337893 2014 Allograft inflammatory factor-1 is an independent prognostic indicator that regulates ?-catenin in gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018427 2013 Effect of allograft inflammatory factor-1 gene polymorphisms on rheumatoid arthritis treatment with methotrexate.
23867161 2013 Daintain/AIF-1 plays roles in coronary heart disease via affecting the blood composition and promoting macrophage uptake and foam cell formation.
23777936 2013 Influence of Cyclooxygenase-2 (COX-2) gene promoter-1195 and allograft inflammatory factor-1 (AIF-1) polymorphisms on allograft outcome in Hispanic kidney transplant recipients.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23547889 2013 Protective effect of allograft inflammatory factor-1 on the apoptosis of fibroblast-like synoviocytes in patients with rheumatic arthritis induced by nitro oxide donor sodium nitroprusside.
23221708 2012 Daintain/AIF-1 reinforces the resistance of breast cancer cells to cisplatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22560794 2012 Serum allograft inflammatory factor-1 is a novel marker for diabetic nephropathy.
22225958 2012 The serum concentration of allograft inflammatory factor-1 is correlated with metabolic parameters in healthy subjects.
22116621 2012 NFAT regulates the expression of AIF-1 and IRT-1: yin and yang splice variants of neointima formation and atherosclerosis.
22106834 2012 Allograft inflammatory factor-1 gene polymorphisms in patients with rheumatoid arthritis.
21720444 2012 Common variants in FTO, MC4R, TMEM18, PRL, AIF1, and PCSK1 show evidence of association with adult obesity in the Greek population.
21509525 2012 Daintain/AIF-1 promotes breast cancer cell migration by up-regulated TNF-? via activate p38 MAPK signaling pathway.
21168672 2010 Cardiac allograft rejection correlates with increased expressions of Toll-like receptors 2 and 4 and allograft inflammatory factor 1.
21040744 2011 Allograft inflammatory factor-1 is overexpressed and induces fibroblast chemotaxis in the skin of sclerodermatous GVHD in a murine model.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20850992 Expression of allograft inflammatory factor-1 (AIF-1) in acute cellular rejection of cardiac allografts.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19745784 2010 Overexpression of allograft inflammatory factor-1 promotes the proliferation and migration of human endothelial cells (HUV-EC-C) probably by up-regulation of basic fibroblast growth factor.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18987644 2009 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families.
18835879 2008 Fine mapping of the MHC Class III region demonstrates association of AIF1 and rheumatoid arthritis.
18816612 2008 Allograft inflammatory factor-1: a pathogenetic factor for vasculitic neuropathy.
18787073 2009 AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis.
18721278 2008 Association of allograft inflammatory factor-1 gene polymorphism with rheumatoid arthritis.
18699778 2008 Structural and functional characterization of human Iba proteins.
18341653 2008 Daintain/AIF-1 promotes breast cancer proliferation via activation of the NF-kappaB/cyclin D1 pathway and facilitates tumor growth.
17907195 2007 T cells expressing allograft inflammatory factor 1 display increased chemotaxis and induce a profibrotic phenotype in normal fibroblasts in vitro.
17533487 2007 Expression of allograft inflammatory factor-1 in inflammatory skin disorders.
17522098 2007 An allograft inflammatory factor 1 (AIF1) single nucleotide polymorphism (SNP) is associated with anticentromere antibody positive systemic sclerosis.
17498268 2007 Allograft inflammatory factor-1 and tumor necrosis factor single nucleotide polymorphisms in systemic sclerosis.
17073733 2006 Crystallization and preliminary crystallographic analysis of allograft inflammatory factor 1.
17035944 2006 Expression of allograft inflammatory factor-1 in kidneys: A novel molecular component of podocyte.
17011575 2006 X-ray structures of the microglia/macrophage-specific protein Iba1 from human and mouse demonstrate novel molecular conformation change induced by calcium binding.
17010532 2007 Potential roles of allograft inflammatory factor-1 in the pathogenesis of hemangiomas.
16868985 2006 Expression of allograft inflammatory factor 1 in tissues from patients with systemic sclerosis and in vitro differential expression of its isoforms in response to transforming growth factor beta.
16291819 2006 Inhibition of AIF-1 expression by constitutive siRNA expression reduces macrophage migration, proliferation, and signal transduction initiated by atherogenic stimuli.
16049345 2005 Expression of allograft inflammatory factor-1 in T lymphocytes: a role in T-lymphocyte activation and proliferative arteriopathies.
15922740 2005 The ability of AIF-1 to activate human vascular smooth muscle cells is lost by mutations in the EF-hand calcium-binding region.
15784173 Genomic rearrangements on VCAM1, SELE, APEG1and AIF1 loci in atherosclerosis.
15523649 2004 High-Density SNP genotyping defines 17 distinct haplotypes of the TNF block in the Caucasian population: implications for haplotype tagging.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15117732 2004 AIF-1 expression modulates proliferation of human vascular smooth muscle cells by autocrine expression of G-CSF.
14756805 2004 Microglia/macrophage-specific protein Iba1 binds to fimbrin and enhances its actin-bundling activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12887599 2003 The allograft inflammatory factor-1 in Creutzfeldt-Jakob disease brains.
12714565 2003 AIF-1 is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.
12559634 2003 TNF, TNF receptor type 1, and allograft inflammatory factor-1 gene polymorphisms in Japanese patients with type 1 diabetes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943136 2002 The allograft inflammatory factor-1 family of proteins.
11557666 2001 Overexpression of allograft inflammatory factor-1 promotes proliferation of vascular smooth muscle cells by cell cycle deregulation.
11500035 2001 Iba1 is an actin-cross-linking protein in macrophages/microglia.
10202016 1999 A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC.
9614071 1998 IRT-1, a novel interferon-gamma-responsive transcript encoding a growth-suppressing basic leucine zipper protein.
9480751 1998 Nucleotide sequencing analysis of the 146-kilobase segment around the IkBL and MICA genes at the centromeric end of the HLA class I region.
9367684 1997 Complex expression pattern of the TNF region gene LST1 through differential regulation, initiation, and alternative splicing.
8912632 1996 cDNA cloning of human allograft inflammatory factor-1: tissue distribution, cytokine induction, and mRNA expression in injured rat carotid arteries.
8629302 1996 Allograft inflammatory factory-1. A cytokine-responsive macrophage molecule expressed in transplanted human hearts.
8499947 1993 Dense Alu clustering and a potential new member of the NF kappa B family within a 90 kilobase HLA class III segment.
8081366 1994 Characterization of a novel gene in the human major histocompatibility complex that encodes a potential new member of the I kappa B family of proteins.
7769138 1995 Cloning and characterization of allograft inflammatory factor-1: a novel macrophage factor identified in rat cardiac allografts with chronic rejection.
7590964 1995 Cloning and genomic characterization of LST1: a new gene in the human TNF region.