Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.07
PubTator Score 158.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
juvenile dermatomyositis 1187 1.2e-17
ovarian cancer 8520 2.0e-07
acute quadriplegic myopathy 1158 6.9e-06

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.180 6.9e-06
juvenile dermatomyositis 1.509 1.2e-17
ovarian cancer -1.800 2.0e-07

AA Sequence

MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCL      1 - 70
ELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGA     71 - 140
GAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVA    141 - 210
SRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPT    211 - 280
DFKRKKLQLLTKKPLYLHLHQTLHKE                                                281 - 306
//

Text Mined References (13)

PMID Year Title