Property Summary

NCBI Gene PubMed Count 208
PubMed Score 602.15
PubTator Score 6539.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
primary Sjogren syndrome 1.100 2.5e-03
ovarian cancer -1.600 8.3e-04
psoriasis -1.100 5.6e-10

 GO Component (2)

Gene RIF (193)

PMID Text
26867650 Data suggest novel mechanism in innate immunity allows cytokine TGF-beta to restrict viral circular DNA in hepatocyte nuclei via innate immunity; AID deaminates circular DNA of hepatitis B virus leading to DNA degradation; mechanism depends on UNG.
26638776 Mutations in activation-induced cytidine deaminase is associated with indolent chronic lymphocytic leukaemia.
26545377 AID mutations leading to AID deficiency are the most frequent underlying molecular basis of hyper IgM syndrome in consanguineous Tunisian patients.
26537386 Studies indicate that gene conversion mediated by activation-induced cytidine deaminase (AID) has been found to contribute to generation of the primary antibody repertoire.
26398702 AICDA/APOBEC family of cytidine deaminases is significant in innate immunity, as it restricts numerous viruses, including HBV, through hypermutationdependent and independent mechanisms. (Review)
26365193 DNA methylation dynamics of germinal center B cells are mediated by AID.
26355458 identify AID derivatives that accelerate somatic hypermutation with minimal impact on viability, which will be useful tools for engineering genes and proteins by iterative mutagenesis and selection
26223652 Data show that microRNAs miR-155 and miR-16 downregulate activation-induced cytidine deaminase (AID) and transcription factor E47 in B Cells through binding of the 3'-untranslated regions.
26219420 aberrant expression of AID may reflect continuous B cell activation and sustained survival signals in HCV-related CV patients.
26166388 The high levels of memory and activated B cells and follicular helper T cells were positively associated with the progression of immunoglobulin A nephropathy. This may be mediated by the overexpression of AID, which is potentially regulated by IL21.
26113087 Data indicate that both the amount and intensity of the activation-induced cytidine deaminase (AID) protein expression increased with the progression from precancerous to cancerous lesions in pancreatic ductal adenocarcinoma (PDAC) tissues.
26077666 High expression of activation-induced cytidine deaminase is associated with diffuse large B cell lymphoma.
25990957 Surges in ERK activity induced by extracellular cues enhance Arp2/3-mediated actin polymerization to generate protrusion power phases sufficient to promote sustained cell motility.
25912253 HSP90 inhibitors indirectly target AID in vivo
25902538 hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation
25486549 Activation-induced cytidine deaminase (AID)-induced mutagenic U:G mismatches in DNA may be a fundamental and common cause of mutations in B-cell malignancies.
25483777 AID activity and its relationship to chromosome folding and the B cell regulome was studied; find that AID-mediated lesions occur predominantly within B cell super-enhancers and regulatory clusters; further show that the structural and transcriptional features of these domains help explain AID tumorigenic activity in the B cell compartment of mice and humans.
25483776 Study reports that the majority of detectable AID off-target activity in a variety of mouse and human lymphoid or nonlymphoid cell types occurs within focal regions of overlapping sense/antisense transcription within intragenic super enhancers.
25237741 In yeast, AID and the catalytic domain of APOBEC3G preferentially mutate transcriptionally active genes within narrow regions, 110 base pairs in width, fixed at RNA polymerase initiation sites.
25179679 data demonstrate that AID is active in CLL in vivo and thus, AID likely contributes to clonal evolution of CLL.
25154417 Results show that both AID mRNA levels and DNA-cytosine deamination activities follow the same general pattern of increase and decline after stimulation in the two genetic backgrounds.
25099163 demonstrates that intensity of malaria transmission correlates with AID expression levels in the presence of Epstein-Barr virus
24973444 AID lacking the C terminus is impaired in its ability to recruit nonhomologous end joining repair factors, resulting in accumulation of double-strand breaks that undergo aberrant resection.
24923561 B cells hijack to supply ssDNA substrates for AID to mutate at immunoglobulin V regions during somatic hypermutation.
24684646 analysis of a possible association between AID expression and BRAF mutation in melanoma
24507160 [review] In a B cell that produces AID protein and undergoes mutation of the V regions of the expressed Ig heavy and light chain genes, only some of the transcription complexes initiating at the active V-region promoters are associated with AID.
24434356 AID physically associates with the major spliceosome subunits (small nuclear ribonucleoproteins, snRNPs), as well as other essential splicing components, in addition to the transcription machinery.
24351917 findings suggest that AID has a role in the development of oral epithelial dysplasia and promotes progression of oral cancer
24349193 DNA repair pathways which are in vitro activated by AID-induced lesions are reminiscent of those found during AID-induced in vivo immunoglobulin diversification.
24282540 HIV-1 Vpr co-localizes with AID in germinal center B cells from HIV-1 patients
24244169 findings reveal additional functions for AID in innate immune defense against KSHV with implications for a broader involvement in innate immunity to other pathogens.
24025329 proinflammatory cytokines IL-1/TNFalpha trigger a novel antiviral mechanism involving AID to regulate host cell permissiveness to HBV infection.
23942124 data suggest a role for nucleotide sugar pucker in explaining the molecular basis for AID's DNA selectivity and, more generally, suggest how other nucleic acid-modifying enzymes may distinguish DNA from RNA
23882083 Data indicate that knockdown of activation-induced cytidine deaminase (AID) suppresses expression of several key epithelial-mesenchymal transition (EMT) transcriptional regulators and increased methylation of CpG islands of these genes.
23820005 aberrant AID expression triggers an auto-activation circuit to consolidate self-expression
23803409 Two patients, sisters from a consanguineous family, were diagnosed with HIGM2 syndrome, and found to be homozygous for a transversion mutation.
23731676 There was no significant association between the previously reported genetic variant of AICDA gene and the development of Common variable immunodeficiency or selective IgA deficiency
23662991 Results show that activation induced cytidine deaminase (AID) expression may be associated with deletions in patients with chronic lymphocytic leukemia (CLL).
23652018 GANP-mediated chromatin modification promotes transcription complex recruitment and positioning at immunoglobulin variable loci to favour AID targeting.
23634222 Aberrant AID expression in the oral epithelium would contribute to the initiation of oral squamous cell carcinoma
23593411 5-FC combined gene therapy with TNF-alpha and CD suicide gene should be an effective treatment on Laryngeal carcinoma.
23589568 This reveals a novel antineoplastic role of AID that can be triggered by inhibition of homologous recombination.
23476051 Both WGCW/WRC and CpG/CGC breaks at BCL6 are most likely initiated by AID in germinal center B-cells, and their differential use suggests subtle mechanistic differences between Ig-BCL6 and non-Ig-BCL6 rearrangements.
23408445 genetic polymorphisms in AICDA and CASP14 are associated with risk for brain tumor in Korean children.
23399385 High levels of AID specifically increased mutations at A, but not T, leading to strand bias.
23363221 LMP1 induces AID up-regulation and genomic instability via Egr-1.
23341589 C-to-T and G-to-A mutations accumulated in hepatitis B virus (HBV) nucleocapsid DNA when AICDA was expressed in HBV-replicating hepatic cell lines.
23277564 identify a unique cofactor, RING finger protein 126 (RNF126), verify its interaction by traditional techniques, and show that it has functional consequences as RNF126 is able to ubiquitylate activation-induced cytidine deaminase
23263985 AID enzymatic activity is important for the fragility at the the human bcl-2 major breakpoint region.
23212122 a critical role for AID activity in the initiation of reprogramming to iPSCs.
23198547 H. pylori infection induces ectopic AID expression in the gastric mucosal cells via NFkappaB activation, resulting in various gene mutations and aberrations in the gastric mucosal cells leading to gastric cancer development.
23190037 B cell defects, as measured by the autonomous AID reporter, in IBD patients contribute to reduced humoral responses to the influenza vaccine, as we have previously shown for elderly individuals.
23166356 Among BCL6 validated targets, miR-155 and miR-361 directly modulate AID expression, indicating that via repression of these miRNAs, BCL6 up-regulates AID.
23133680 LINE-1 retroelements are complexed and inhibited by activation induced cytidine deaminase
23071276 Data suggest that the production of fully functional activation-induced deaminase (AID) protein by IGHV-unmutated (U-CLL) and IGHV-mutated chronic lymphocytic leukemia (M-CLL) cells could be involved in clonal evolution of the disease.
23017209 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
23008333 Data show that activation-induced deaminase (AID) associates with RNA polymerase-associated factor 1 (PAF1) through its N-terminal domain.
22992148 report of two siblings of a Tajik family with a hyper-immunoglobulin M (HIGM) syndrome phenotype in which a novel missense mutation in the activation-induced cytidine deaminase (AICDA) gene was detected
22962683 DNA sequence preference may serve as an additional layer of AID regulation by restricting its mutagenic activity to specific sequences, despite the observation that AID has the potential to access the genome widely.
22899287 We suggest that duodenal follicular lymphoma cells are in the memory B-cell stage, and require BACH2 instead of AID for ongoing mutation.
22843687 Spt6 is a unique histone chaperone capable of regulating the histone epigenetic state of both AID targets and the AID locus.
22798497 While APOBEC3A was a strong deaminator of both C and 5-methylcytosine, AID was much weaker in it's ability to deaminate this modified base.
22715099 A structural analysis is presented that shows how localized defects in different regions of AID can contribute to loss of catalytic function.
22492685 An ortholog of AID was, evolutionarily, the first enzyme to generate acquired immune diversity by catalyzing gene conversion and probably somatic hypermutation. (Review)
22469133 Findings suggest that activation-induced cytidine deaminase (AID) plays an integral role in inflammation-associated carcinogenesis and is therefore a potential target molecule for the prevention and treatment of cancers.
22466889 aberrant AID expression may play an important role in the dysplasia-carcinoma sequence in the oral cavity
22446380 The data suggested that the present-day human APOBEC3B enzyme retained the nuclear import mechanism of an ancestral activation-induced cytosine deaminase during the expansion of the APOBEC3 locus in primates.
22391874 Hypermutable bases (both paired and unpaired) are made accessible to activation-induced cytidine deaminase in stabilised DNA secondary structures formed with increasing transcription levels
22363466 Lysine modification may represent a novel level of AID regulation.
22308462 Along with known AID targets, this screen identified a set of unique genes (SNHG3, MALAT1, BCL7A, and CUX1) and confirmed that these loci accumulated mutations as frequently as Ig locus after AID activation
22234692 Data show that interaction between myeloma and dendritic cell (DC), but not monocytes, leads to rapid induction of the genomic mutator activation-induced cytidine deaminase (AID) and AID-dependent DNA double-strand breaks (DSBs) in myeloma cell.
22205734 HIV-1 Vpr co-localizes with AID in germinal center B cells from HIV-1 patients
22198384 Data suggest that AID may generate DNA damage with variable efficiencies in different organisms, identify residues critical in regulating AID activity, and provide insights into the evolution of the APOBEC family of enzymes.
22168746 AID may act as a negative regulator of cell survival in follicular lymphoma when sufficient c-myc is expressed
22080610 Activation-induced cytidine deaminase -induced decrease in Top1 is critical for somatic hypermutation.
22034886 Activation-induced cytidine deaminase is associated with inflammation in ulcerative colitis, whereas it may not specifically contribute to carcinogenesis
21984922 Analysis of co-regularities and creation of AID-associated functional network gives an integrated view of biological processes and might be further applied to assess role of altered AID expression in etiology of other diseases.
21831295 Findings demonstrate that miR-93 and miR-155 constitutively suppress AID translation in MCF-7 cells, suggesting widespread roles for these miRs in preventing genome cytidine deaminations, mutagenesis, and oncogenic transformation.
21700883 identified a major and previously unsuspected role for AID in the removal of developing autoreactive B cells
21659520 Phosphorylation directly regulates the intrinsic DNA cytidine deaminase activity of activation-induced deaminase and APOBEC3G protein
21570118 Activation-induced deaminase (AID) expression is correlated with Bcr-Abl expression in chronic myelocytic leukemia-B-lymphoid blast cells.
21290192 High expression and mutation-inducing activity of AID is associayed with human lung cancer.
21268017 Ig class-switch recombination, as well as the stabilisation of AID, depend on an interaction between the AID C-terminal decapeptide and factor(s) additional to Crm1.
21255825 Study implicates the RNA exosome, a cellular RNA-processing/degradation complex, in targeting AID to both DNA strands.
21133730 AID overexpression promotes chromosomal abnormalities and is associated with chronic lymphocytic leukemia progression
21109971 AID and inducible nitric oxide synthase expression in cancer cells may be modified by epigenetic mechanisms
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21041454 Hsp90 inhibition provides the first pharmacological means to down-regulate AID expression and activity.
20974684 The constitutive expression of AID in ATL cells can be speculated to result from mutations induced by the Tax-activated AID and/or other Tax-associated mutagenic mechanisms
20927319 Low Cytidine Deaminase is associated with gemcitabine resistance in pancreatic cancer.
20878190 findings suggest that pro-inflammatory cytokine-mediated aberrant expression of AICDA in colonic epithelial cells plays a role as a genotoxic factor that enhances genetic instability during chronic colonic inflammation, leading to colorectal cancer
20864035 Exogenous and intrinsic AID-induced DNA strand breaks in B-cells activate ATM, which signals through an LKB1 intermediate to inactivate CRTC2, resulting in repression of germinal center B-cell differentiation, while opposing lymphomagenesis.
20855884 Esr1 bind to and activate the HOXC4 promoter to potentiate HoxC4-mediated AID induction, immunoglobulin class switch and somatic hypermutation.
20729863 14-3-3 proteins specifically bound 5'-AGCT-3' repeats, were upregulated in B cells undergoing class switch DNA recombination (CSR) and were recruited with AID to the switch regions that are involved in CSR events
20637757 AID-mediated genotoxic effects appear to occur frequently at the CDKN2b-CDKN2a locus and contribute to malignant transformation of the gastric mucosa
20507984 GANP may serve as an essential link required to transport AID to B-cell nuclei and to target AID to actively transcribed IgV regions
20491788 The ectopic expression of AICDA in rheumatoid arthritis fibroblast-like synoviocytes (RA-FLS) causes TP53 somatic mutations & dysfunction, leading to acquisition of tumour-like properties by RA-FLS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373075 The researchers found no evidence of an association between the AICDA 7888 C/T polymorphism and the risk of gastric atrophy or gastric neoplasms in the study group.
20373075 Observational study of gene-disease association. (HuGE Navigator)
20338830 the sequence selectivity of APOBEC family of enzymes
20237507 Higher expression levels of activation-induced cytidine deaminase distinguish hairy cell leukemia from hairy cell leukemia-variant and splenic marginal zone lymphoma.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233972 High expression of AID and active class switch recombination might account for a more aggressive disease in unmutated CLL patients: link with an activated microenvironment in CLL disease.
20118283 Findings underscore that AID splice variants are unlikely to have preservation of catalytic activity.
20117026 Expression of at least one AID-mRNA isoform predominated among mutated IgG vs. mutated IgMD. AID splice variants may inhibit somatic hypermutation in chronic lymphocytic leukemia cells of the unmutated subtype.
20048284 Altering the spectrum of immunoglobulin V gene somatic hypermutation by modifying the active site of AID.
20027182 data provide new evidence that mammalian AID is required for active DNA demethylation and initiation of nuclear reprogramming towards pluripotency in human somatic cells
19966806 Aicda is regulated by the balance between B cell-specific and stimulation-responsive elements and ubiquitous silencers.
19911124 Studies indicate the APOBEC family consists of 11 members: APOBEC-1 (Apo1), APOBEC-2 (Apo2), activation induced cytidine deaminase (AID), APOBEC- 3A, -3B, -3C, -3DE, -3F, -3H (Apo3A-H) and APOBEC- 4 (Apo4).
19898425 AID expression is an indicator of an unfavorable prognosis in chronic lymphocytic leukemia/small lymphocytic lymphoma patients
19859091 Observational study of genetic testing. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19741596 However, no activation-induced cytidine deaminase (AID) expression (an absolute requirement for class switching) was detected in lamina propria
19734146 SLIP-GC is a replication-related protein in germinal center B cells whose reduction is toxic to cells through an AICDA-dependent mechanism.
19732723 ACIDA promotes B lymphoid blast crisis and drug resistance in chronic myeloid leukemia.
19703021 The higher levels of AID expression in B cells of Reumatoid Arthritis patients correlate with the higher levels of T helper cell cytokines IFN-gamma and IL-17.
19667096 Both mice and humans share a latent, AID-dependent pathway for the preimmune diversification of B lymphocytes.
19578742 abnormal over-expression of GANP together with AID might be associated with rigorous DNA damage, potentially causing the malignant development of Cholangiocarcinoma (CCAs) during long-term inflammation.
19575287 in hyper-IgM syndrome, one novel AICDA mutation (E122X) was detected
19573080 Observational study of gene-disease association. (HuGE Navigator)
19561087 When recognition loop of 9-11 amino acids is grafted from the donor APOBEC3F or 3G proteins into the acceptor scaffold of AID, the mutational signature of AID changes toward that of the donor proteins.
19443686 AID targeting of hot and cold spots is a key part of the mutation process, our results suggest that the sequence environment plays an equally important role
19412186 Two other mechanisms involved in controlling AID subcellular localization, are identified.
19380635 AID acts processively in naked DNA and DNA organized within transcribed nucleosomes.
19363484 HoxC4 directly activates the Aicda promoter
19336552 Observational study of gene-disease association. (HuGE Navigator)
19309412 The expression of activation induced cytidine deaminase in follicular lymphoma is independent of prognosis and stage.
19266080 sensitive gel electrophoresis (CSGE) and sequencing analysis of AICDA coding sequences demonstrated sequence heterogeneity due to 5923A/G and 7888C/T polymorphisms, but did not reveal any novel mutation that might explain the selective IgE deficit.
19247692 Observational study of gene-disease association. (HuGE Navigator)
19196959 class switch recombination activity of AID requires an ACF-like cofactor that specifically interacts with the carboxy-terminal domain of AID
19139166 Estrogen regulates gene expression of AID at the transcriptional level.
19023113 in the absence of CD40-CD154 interactions, there is a marked reduction in SHM and, specifically, mutations of AICDA-targeted G residues in RGYW motifs along with a decrease in transversions normally related to UNG2 activity.
19017972 V(H)4 replacement in preimmune human B cells is mediated by an AICDA-independent mechanism resulting from inefficient but selective RAG activity.
18940926 results lead to a model for exonuclease 1 function in class switch recombination in which cleavage at activation-induced deaminase (AID)-initiated nicks produces gaps that become substrates for further attack by AID and subsequent repair
18776814 expressed in bone marrow infiltrates of malignant lymphoma
18772346 AID can cause single-base substitutions or multiple clustered mutations depending on the transcriptional activity of T7 RNA polymerase.
18760480 AID and Ung generate staggered double-strand DNA breaks (DSBs) not only by cleaving intact double-strand DNA, but also by processing blunt DSB ends.
18757891 Results identify non-conservative homologous recombination as a novel DNA transaction pathway promoted by activation-induced cytidine deaminase.
18722174 The results, therefore, identify residues in AID involved in its in vivo targeting and suggest they might act through interaction with CTNNBL1, giving possible insight into the linkage between AID recruitment and target-gene transcription.
18417471 analysis of the effect of phosphorylation and phosphorylation-null mutants on the activity and deamination specificity of activation-induced cytidine deaminase
18391550 Aberrant expression of activation-induced cytidine deaminase may contribute to the development of gastric cancers and induce p53 nuclear expression
18390709 results obtained with activated CD19(+) B cells show that the expression of E47, activation-induced cytidine deaminase, and Iggamma1 circle transcripts progressively decrease with age
18329947 aberrant AID expression can be triggered by several pathogenic factors, including Helicobacter pylori infection & proinflammatory cytokines, in human epithelial cells, but AID expression is absent in those cells under physiologic conditions[review].
18306229 The proinflammatory cytokine-induced aberrant production of AID might link bile duct inflammation to an enhanced genetic susceptibility to mutagenesis, leading to cholangiocarcinogenesis
18213388 generation of phase 1 mutations is not a prerequisite for the expression of phase 2 mutations
17878393 AID retains its exclusive association with numerous, residual germinal centers in parotid Sjogren's syndrome-MALT lymphomas, whereas neoplastic marginal zone-like B cells are consistently AID negative
17638864 primary mediastinal B-cell lymphoma (PMBL), an immunoglobulin (Ig)-negative lymphoma that possesses hypermutated, class-switched Ig genes, expresses high levels of AID with an intact primary structure but does not do class switch recombination
17485517 AID is a BCR-ABL1-induced mutator in Philadelphia chromosome(+) acute lymphoblastic leukemia cells, which may be relevant to the particularly unfavorable prognosis of this leukemia subset.
17161027 AID is alone unable to act processively on any of a number of DNA substrates
17132718 cells may be the founder cells of the germinal center reaction (a pro-GC cell) and may be the normal counterpart of the mantle cell lymphoma cell
17066440 Findings suggest that the aberrant expression of AID is observed in human hepatocytes with several pathological settings, including chronic liver disease and hepatocellular carcinoma.
17060445 AID may persist on immunoglobulin and other target sequences after deamination, possibly acting as a scaffolding protein to recruit other factors
16999936 APOBEC3G is not a nucleo-cytoplasmic shuttling protein like APOBEC-1 and AID
16785531 Features of activation-induced deaminase (AID) mapping within the noncatalytic domain, but outside the chromosome region maintenance 1-dependent nuclear export signal at the C-terminus, influence its function.
16705187 AID binds DNA exposed by the transcribing polymerase, implicating the polymerase itself as the vehicle which distributes AID on DNA as it moves away from the promoter.
16624806 review of the role of AICDA in producing high affinity isotype-switched antibodies [review]
16580072 HIV-1 Vpr co-localizes with AID in germinal center B cells from HIV-1 patients
16541139 The AID expression and ASHM are associated with higher-grade transformation of CLL and provide further evidences that AID expression and ASHM may be activated during the clonal history of B-cell lymphomas.
16439679 The distribution of nuclear AID is consistent with the topography of somatic hypermutation and class switch recombination in activated B cells.
16387847 control of T cell-dependent immune responses may be modulated, via AID, by signals that activate protein kinase A
16314506 Somatic hypermutation on both DNA strands is the natural outcome of AID action on a transcribed gene.
16269615 interfollicular large B cells and AID-expressing B lymphocytes of the thymic medulla could give rise to mature B-cell malignancies.
16122802 AID can interact with MDM2, an oncoprotein that shuttles between the nucleus and the cytoplasm and targets p53 for nuclear export and degradation.
15949042 AID-mediated deamination of DNA is a major cause of mutations at G-C base pairs in immunoglobulin genes during somatic hypermutation. Its intrinsic substrate specificity is a primary determinant of mutational hotspots at G-C base pairs during SHM.
15944282 Direct evidence is presented for the DNA deamination from Escherichia coli expressing AID; uracils are preferentially generated at cytosines in the nontranscribed strand during transcription.
15613101 expression in acute lymphoblastic leukemia L2 with t(14;18)(q32;q21)
15593119 AID overexpression by itself does not automatically lead to the onset of a mutator phenotype.
15448152 Aid and perhaps some of its family members may have roles in epigenetic reprogramming
15372234 novel mutation found in the gene encoding for activation-induced cytidine deaminase in a Tunisian family with hyper-IgM type 2 syndrome
15371439 wild type AID retains its specificity for mutated hot spot motifs within the confines of a moving transcription bubble while introducing clusters of multiple deaminations predominantly on the nontranscribed strand
15304391 AID protein is specifically expressed in normal and transformed germinal center B cells
15195091 separate domains of AID interact with specific cofactors to regulate these two distinct genetic events in a target-specific way
15182647 Observational study of gene-disease association. (HuGE Navigator)
15148397 results suggested both AID and APOBEC-1 are equally likely to bind single-stranded DNA or RNA, which has implications for the identification of natural AID targets
15087440 Activation-induced cytosine deaminase (AID) is actively exported out of the nucleus but retained by the induction of DNA breaks
15061213 expression of AID in 15 Burkitt's lymphoma cell lines by RT-PCR
14990977 AID expression was associated with the ongoing mutation in follicular lymphoma (FL) fresh cells. Results suggest the switch off of AID expression may start in the B-lineage differentiation stage counterpart of FL after optimizing somatic hypermutation
14769937 AID is a nucleocytoplasmic shuttling protein with a bipartite nuclear localization signal and a nuclear export signal in its N and C termini, respectively
14551145 AID transcripts, including a splice variant, were common to both unmutated or mutated VH genes in mantle cell lymphoma.
14536088 there is an essential role for the C-terminal domain of AID in CSR that is independent of its cytidine deaminase activity and that is not required for either gene conversion or somatic hypermutation
12973929 Observational study of gene-disease association. (HuGE Navigator)
12928399 Activation-induced cytidine deaminase plays a crucial role in the induction of DNA breakage during immunoglobulin class switch recombination.
12873980 Expression of activation-induced cytidine deaminase is confined to B-cell non-Hodgkin's lymphomas of germinal-center phenotype.
12855567 data suggest that AID-mediated DNA alterations may occur in a variably sized, minor subset of B-CLL cells at any given time.
12799424 Activation-induced cytidine deaminase causes transcription-dependent, strand-biased C to U deaminations.
12715918 has the function to induce spontaneous IgM production in B cells
12521993 Chronic lymphocytic leukemia B cells that express this enzyme display dissociation between class switch recombination and somatic hypermutation
12511417 AID is highly regulated during normal B-cell development & is constitutively expressed in human germinal center B-NHL & in subsets of nongerminal center B-NHL. This constitutive expression may cause illegitimate recombination & somatic mutation in B-NHL.
12202747 Somatic hypermutation of the AID transgene in B and non-B cells
12114543 Internal IgH class switch region deletions are position-independent and enhanced by expression
12097915 AID mutates E. coli suggesting a DNA deamination mechanism for antibody diversification.
11823785 required for somatic hypermutation in the centroblast-like Ramos cells; sufficient to induce somatic hypermutation in hybridoma cells, which represent a later stage of B-cell differentiation that does not normally undergo SHM

AA Sequence

MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDL      1 - 70
DPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMT     71 - 140
FKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL                141 - 198
//

Text Mined References (209)

PMID Year Title
26867650 2016 TGF-? triggers HBV cccDNA degradation through AID-dependent deamination.
26638776 2015 Whole-genome sequencing reveals activation-induced cytidine deaminase signatures during indolent chronic lymphocytic leukaemia evolution.
26545377 2016 Novel and recurrent AID mutations underlie prevalent autosomal recessive form of HIGM in consanguineous patients.
26537386 2015 Diversification of the Primary Antibody Repertoire by AID-Mediated Gene Conversion.
26398702 2015 Associations between activation-induced cytidine deaminase/apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like cytidine deaminase expression, hepatitis B virus (HBV) replication and HBV-associated liver disease (Review).
26365193 2015 DNA Methylation Dynamics of Germinal Center B Cells Are Mediated by AID.
26355458 2015 Cell Cycle Regulates Nuclear Stability of AID and Determines the Cellular Response to AID.
26223652 2015 MicroRNAs miR-155 and miR-16 Decrease AID and E47 in B Cells from Elderly Individuals.
26219420 2015 Activation-induced cytidine deaminase in B cells of hepatits C virus-related cryoglobulinaemic vasculitis.
26166388 2015 Increased frequencies of memory and activated B cells and follicular helper T cells are positively associated with high levels of activation?induced cytidine deaminase in patients with immunoglobulin A nephropathy.
26113087 2015 Activation-Induced Cytidine Deaminase Contributes to Pancreatic Tumorigenesis by Inducing Tumor-Related Gene Mutations.
26077666 2016 Expression of activation-induced cytidine deaminase is associated with a poor prognosis of diffuse large B cell lymphoma patients treated with CHOP-based chemotherapy.
25990957 2015 ERK reinforces actin polymerization to power persistent edge protrusion during motility.
25912253 2015 HSP90 inhibitors decrease AID levels and activity in mice and in human cells.
25902538 2015 Identification of DNA cleavage- and recombination-specific hnRNP cofactors for activation-induced cytidine deaminase.
25486549 2015 AID expression in B-cell lymphomas causes accumulation of genomic uracil and a distinct AID mutational signature.
25483777 2014 B cell super-enhancers and regulatory clusters recruit AID tumorigenic activity.
25483776 2014 Convergent transcription at intragenic super-enhancers targets AID-initiated genomic instability.
25237741 2014 Active RNAP pre-initiation sites are highly mutated by cytidine deaminases in yeast, with AID targeting small RNA genes.
25179679 2014 AID induces intraclonal diversity and genomic damage in CD86(+) chronic lymphocytic leukemia cells.
25154417 2014 Genomic uracil homeostasis during normal B cell maturation and loss of this balance during B cell cancer development.
25099163 2015 AID expression in peripheral blood of children living in a malaria holoendemic region is associated with changes in B cell subsets and Epstein-Barr virus.
24973444 2014 Mismatch repair proteins and AID activity are required for the dominant negative function of C-terminally deleted AID in class switching.
24923561 2014 A source of the single-stranded DNA substrate for activation-induced deaminase during somatic hypermutation.
24684646 2014 Expression of AID in malignant melanoma with BRAF(V600E) mutation.
24507160 2014 Why does somatic hypermutation by AID require transcription of its target genes?
24434356 2014 Activation-induced cytidine deaminase (AID) is localized to subnuclear domains enriched in splicing factors.
24351917 2013 Expression of activation-induced cytidine deaminase in oral epithelial dysplasia and oral squamous cell carcinoma.
24349193 2013 Simultaneous in vitro characterisation of DNA deaminase function and associated DNA repair pathways.
24244169 2013 A role for host activation-induced cytidine deaminase in innate immune defense against KSHV.
24025329 2013 Interleukin-1 and tumor necrosis factor-? trigger restriction of hepatitis B virus infection via a cytidine deaminase activation-induced cytidine deaminase (AID).
23942124 2013 Nucleic acid determinants for selective deamination of DNA over RNA by activation-induced deaminase.
23882083 2013 Activation-induced cytidine deaminase (AID) is necessary for the epithelial-mesenchymal transition in mammary epithelial cells.
23820005 2013 Activation-induced cytidine deaminase auto-activates and triggers aberrant gene expression.
23803409 2013 A novel activation-induced cytidine deaminase (AID) mutation in Brazilian patients with hyper-IgM type 2 syndrome.
23731676 AICDA single nucleotide polymorphism in common variable immunodeficiency and selective IgA deficiency.
23662991 2014 Analysis of activation-induced cytidine deaminase mRNA levels in patients with chronic lymphocytic leukemia with different cytogenetic status.
23652018 2013 GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy.
23634222 2013 Role of activation-induced cytidine deaminase in the development of oral squamous cell carcinoma.
23593411 2013 In vitro and in vivo effect of 5-FC combined gene therapy with TNF-? and CD suicide gene on human laryngeal carcinoma cell line Hep-2.
23589568 2013 Attenuating homologous recombination stimulates an AID-induced antileukemic effect.
23476051 2013 BCL6 breaks occur at different AID sequence motifs in Ig-BCL6 and non-Ig-BCL6 rearrangements.
23408445 2013 Genetic variants of AICDA/CASP14 associated with childhood brain tumor.
23399385 2013 High levels of AID cause strand bias of mutations at A versus T in Burkitt's lymphoma cells.
23363221 2013 Epstein-Barr virus latent membrane protein 1 increases genomic instability through Egr-1-mediated up-regulation of activation-induced cytidine deaminase in B-cell lymphoma.
23341589 2013 RNA editing of hepatitis B virus transcripts by activation-induced cytidine deaminase.
23277564 2013 Solubility-based genetic screen identifies RING finger protein 126 as an E3 ligase for activation-induced cytidine deaminase.
23263985 2013 Both CpG methylation and activation-induced deaminase are required for the fragility of the human bcl-2 major breakpoint region: implications for the timing of the breaks in the t(14;18) translocation.
23212122 2013 A critical role for AID in the initiation of reprogramming to induced pluripotent stem cells.
23198547 2012 [Chronic inflammation and gastric cancer development].
23190037 2013 AID in aging and autoimmune diseases.
23166356 2012 BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.
23133680 2012 LINE-1 retroelements complexed and inhibited by activation induced cytidine deaminase.
23071276 2012 IGHV-unmutated and IGHV-mutated chronic lymphocytic leukemia cells produce activation-induced deaminase protein with a full range of biologic functions.
23017209 2012 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
23008333 2012 A role for the RNA pol II-associated PAF complex in AID-induced immune diversification.
22992148 2012 Novel mutation of the activation-induced cytidine deaminase gene in a Tajik family: special review on hyper-immunoglobulin M syndrome.
22962683 2012 Target DNA sequence directly regulates the frequency of activation-induced deaminase-dependent mutations.
22899287 2013 Duodenal follicular lymphoma lacks AID but expresses BACH2 and has memory B-cell characteristics.
22843687 2012 The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation.
22798497 2012 Efficient deamination of 5-methylcytosines in DNA by human APOBEC3A, but not by AID or APOBEC3G.
22715099 2012 A structural basis for the biochemical behavior of activation-induced deoxycytidine deaminase class-switch recombination-defective hyper-IgM-2 mutants.
22492685 2012 An evolutionary view of the mechanism for immune and genome diversity.
22469133 2012 Inflammation-mediated genomic instability: roles of activation-induced cytidine deaminase in carcinogenesis.
22466889 2012 Activation-induced cytidine deaminase mRNA expression in oral squamous cell carcinoma-derived cell lines is upregulated by inflammatory cytokines.
22446380 2012 APOBEC3B and AID have similar nuclear import mechanisms.
22391874 2012 Stabilised DNA secondary structures with increasing transcription localise hypermutable bases for somatic hypermutation in IGHV3-23.
22363466 2012 Lysine residue at position 22 of the AID protein regulates its class switch activity.
22308462 2012 Nonimmunoglobulin target loci of activation-induced cytidine deaminase (AID) share unique features with immunoglobulin genes.
22234692 2012 Dendritic cell-mediated activation-induced cytidine deaminase (AID)-dependent induction of genomic instability in human myeloma.
22198384 2012 Differences in the enzymatic efficiency of human and bony fish AID are mediated by a single residue in the C terminus modulating single-stranded DNA binding.
22168746 2012 Role of activation-induced cytidine deaminase in the progression of follicular lymphoma.
22085931 2012 Optimal functional levels of activation-induced deaminase specifically require the Hsp40 DnaJa1.
22080610 2011 Decrease in topoisomerase I is responsible for activation-induced cytidine deaminase (AID)-dependent somatic hypermutation.
22034886 2011 Expression of activation-induced cytidine deaminase in ulcerative colitis-associated carcinogenesis.
21984922 2011 Activation-induced cytidine deaminase (AID)-associated multigene signature to assess impact of AID in etiology of diseases with inflammatory component.
21831295 2011 Repression of human activation induced cytidine deaminase by miR-93 and miR-155.
21722948 2011 Thymine DNA glycosylase is essential for active DNA demethylation by linked deamination-base excision repair.
21700883 2011 Activation-induced cytidine deaminase (AID) is required for B-cell tolerance in humans.
21659520 2011 Phosphorylation directly regulates the intrinsic DNA cytidine deaminase activity of activation-induced deaminase and APOBEC3G protein.
21570118 2011 AID expression is correlated with Bcr-Abl expression in CML-LBC and can be down-regulated by As2O3 and/or imatinib.
21518874 2011 Histone chaperone Spt6 is required for class switch recombination but not somatic hypermutation.
21496894 2011 Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain.
21385873 2011 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31.
21290192 2011 Aberrant expression and mutation-inducing activity of AID in human lung cancer.
21268017 2011 The dependence of Ig class-switching on the nuclear export sequence of AID likely reflects interaction with factors additional to Crm1 exportin.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
21133730 2011 Activation-induced cytidine deaminase mRNA levels in chronic lymphocytic leukemia.
21109971 2011 Ectopic expression of activation-induced cytidine deaminase caused by epigenetics modification.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21041454 2010 Regulation of activation-induced deaminase stability and antibody gene diversification by Hsp90.
20974684 2011 Activation of AID by human T-cell leukemia virus Tax oncoprotein and the possible role of its constitutive expression in ATL genesis.
20927319 2010 Gene expression levels as predictive markers of outcome in pancreatic cancer after gemcitabine-based adjuvant chemotherapy.
20878190 2011 Involvement of activation-induced cytidine deaminase in the development of colitis-associated colorectal cancers.
20864035 2010 AID-induced genotoxic stress promotes B cell differentiation in the germinal center via ATM and LKB1 signaling.
20855884 2010 Estrogen receptors bind to and activate the HOXC4/HoxC4 promoter to potentiate HoxC4-mediated activation-induced cytosine deaminase induction, immunoglobulin class switch DNA recombination, and somatic hypermutation.
20729863 2010 14-3-3 adaptor proteins recruit AID to 5'-AGCT-3'-rich switch regions for class switch recombination.
20637757 2010 Up-regulation of activation-induced cytidine deaminase causes genetic aberrations at the CDKN2b-CDKN2a in gastric cancer.
20507984 2010 GANP-mediated recruitment of activation-induced cytidine deaminase to cell nuclei and to immunoglobulin variable region DNA.
20491788 2010 TP53 mutations coincide with the ectopic expression of activation-induced cytidine deaminase in the fibroblast-like synoviocytes derived from a fraction of patients with rheumatoid arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373075 2010 No association between AICDA 7888 C/T polymorphism, Helicobacter pylori seropositivity, and the risk of atrophic gastritis and gastric cancer in Japanese.
20338830 2010 Determinants of sequence-specificity within human AID and APOBEC3G.
20237507 2010 Higher expression levels of activation-induced cytidine deaminase distinguish hairy cell leukemia from hairy cell leukemia-variant and splenic marginal zone lymphoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233972 2010 High expression of AID and active class switch recombination might account for a more aggressive disease in unmutated CLL patients: link with an activated microenvironment in CLL disease.
20118283 2010 Activation-induced cytidine deaminase splice variants are defective because of the lack of structural support for the catalytic site.
20117026 2010 Activation-induced cytidine deaminase splicing patterns in chronic lymphocytic leukemia.
20048284 2010 Altering the spectrum of immunoglobulin V gene somatic hypermutation by modifying the active site of AID.
20027182 2010 Reprogramming towards pluripotency requires AID-dependent DNA demethylation.
19966806 2010 B cell-specific and stimulation-responsive enhancers derepress Aicda by overcoming the effects of silencers.
19911124 2009 APOBEC deaminases-mutases with defensive roles for immunity.
19898425 2010 AID protein expression in chronic lymphocytic leukemia/small lymphocytic lymphoma is associated with poor prognosis and complex genetic alterations.
19859091 2009 Customised molecular diagnosis of primary immune deficiency disorders in New Zealand: an efficient strategy for a small developed country.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19741596 2009 Gut-associated lymphoid tissue contains the molecular machinery to support T-cell-dependent and T-cell-independent class switch recombination.
19734146 2009 Speckled-like pattern in the germinal center (SLIP-GC), a nuclear GTPase expressed in activation-induced deaminase-expressing lymphomas and germinal center B cells.
19732723 2009 The B cell mutator AID promotes B lymphoid blast crisis and drug resistance in chronic myeloid leukemia.
19703021 2009 Increased expression of activation-induced cytidine deaminase is associated with anti-CCP and rheumatoid factor in rheumatoid arthritis.
19667096 2009 Activation-induced cytidine deaminase expression and activity in the absence of germinal centers: insights into hyper-IgM syndrome.
19578742 2009 Cholangiocarcinomas associated with long-term inflammation express the activation-induced cytidine deaminase and germinal center-associated nuclear protein involved in immunoglobulin V-region diversification.
19575287 2009 Clinical and laboratory findings in hyper-IgM syndrome with novel CD40L and AICDA mutations.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19561087 2009 A portable hot spot recognition loop transfers sequence preferences from APOBEC family members to activation-induced cytidine deaminase.
19443686 2009 V-region mutation in vitro, in vivo, and in silico reveal the importance of the enzymatic properties of AID and the sequence environment.
19412186 2009 Active nuclear import and cytoplasmic retention of activation-induced deaminase.
19380635 2009 The activation-induced cytidine deaminase (AID) efficiently targets DNA in nucleosomes but only during transcription.
19363484 2009 HoxC4 binds to the promoter of the cytidine deaminase AID gene to induce AID expression, class-switch DNA recombination and somatic hypermutation.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
19309412 2009 The expression of activation induced cytidine deaminase in follicular lymphoma is independent of prognosis and stage.
19266080 2008 Molecular analysis of activation-induced cytidine deaminase gene in immunoglobulin-E deficient patients.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19196959 2009 Carboxy-terminal domain of AID required for its mRNA complex formation in vivo.
19139166 2009 Estrogen directly activates AID transcription and function.
19023113 2009 Analysis of somatic hypermutation in X-linked hyper-IgM syndrome shows specific deficiencies in mutational targeting.
19017972 2008 An activation-induced cytidine deaminase-independent mechanism of secondary VH gene rearrangement in preimmune human B cells.
18940926 2008 Activities of human exonuclease 1 that promote cleavage of transcribed immunoglobulin switch regions.
18776814 2008 Expression of activation-induced cytidine deaminase in malignant lymphomas infiltrating the bone marrow.
18772346 2009 Transcriptional pausing and stalling causes multiple clustered mutations by human activation-induced deaminase.
18760480 2008 AID- and Ung-dependent generation of staggered double-strand DNA breaks in immunoglobulin class switch DNA recombination: a post-cleavage role for AID.
18757891 2008 Non-conservative homologous recombination in human B lymphocytes is promoted by activation-induced cytidine deaminase and transcription.
18722174 2008 Interaction between antibody-diversification enzyme AID and spliceosome-associated factor CTNNBL1.
18417471 2008 Impact of phosphorylation and phosphorylation-null mutants on the activity and deamination specificity of activation-induced cytidine deaminase.
18391550 2007 Activation-induced cytidine deaminase expression in gastric cancer.
18390709 2008 Aging down-regulates the transcription factor E2A, activation-induced cytidine deaminase, and Ig class switch in human B cells.
18329947 2008 Aberrant AID expression and human cancer development.
18306229 2008 Activation-induced cytidine deaminase links bile duct inflammation to human cholangiocarcinoma.
18213388 2008 Ectopic expression of AID in a non-B cell line triggers A:T and G:C point mutations in non-replicating episomal vectors.
17878393 2007 Activation-induced cytidine deaminase expression in follicular dendritic cell networks and interfollicular large B cells supports functionality of ectopic lymphoid neogenesis in autoimmune sialoadenitis and MALT lymphoma in Sjögren's syndrome.
17638864 2007 Target sequence accessibility limits activation-induced cytidine deaminase activity in primary mediastinal B-cell lymphoma.
17485517 2007 Activation-induced cytidine deaminase acts as a mutator in BCR-ABL1-transformed acute lymphoblastic leukemia cells.
17161027 2007 The nuclear DNA deaminase AID functions distributively whereas cytoplasmic APOBEC3G has a processive mode of action.
17132718 2007 A novel human B cell subpopulation representing the initial germinal center population to express AID.
17066440 2007 Expression of activation-induced cytidine deaminase in human hepatocytes during hepatocarcinogenesis.
17060445 2007 AID associates with single-stranded DNA with high affinity and a long complex half-life in a sequence-independent manner.
16999936 2006 APOBEC-1 and AID are nucleo-cytoplasmic trafficking proteins but APOBEC3G cannot traffic.
16785531 2006 Structural phylogenetic analysis of activation-induced deaminase function.
16705187 2006 The transcription elongation complex directs activation-induced cytidine deaminase-mediated DNA deamination.
16624806 2006 First AID (activation-induced cytidine deaminase) is needed to produce high affinity isotype-switched antibodies.
16541139 2006 Richter's and prolymphocytic transformation of chronic lymphocytic leukemia are associated with high mRNA expression of activation-induced cytidine deaminase and aberrant somatic hypermutation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16439679 2006 Nuclear and cytoplasmic AID in extrafollicular and germinal center B cells.
16387847 2006 PKA-mediated phosphorylation regulates the function of activation-induced deaminase (AID) in B cells.
16381901 2006 The LIFEdb database in 2006.
16314506 2005 Targeting of the activation-induced cytosine deaminase is strongly influenced by the sequence and structure of the targeted DNA.
16269615 2006 AID expression identifies interfollicular large B cells as putative precursors of mature B-cell malignancies.
16122802 2006 MDM2 can interact with the C-terminus of AID but it is inessential for antibody diversification in DT40 B cells.
15949042 2005 Expression of human AID in yeast induces mutations in context similar to the context of somatic hypermutation at G-C pairs in immunoglobulin genes.
15944282 2005 Deoxyuridine is generated preferentially in the nontranscribed strand of DNA from cells expressing activation-induced cytidine deaminase.
15814733 2005 Allergen drives class switching to IgE in the nasal mucosa in allergic rhinitis.
15613101 2005 Presence of somatic hypermutation and activation-induced cytidine deaminase in acute lymphoblastic leukemia L2 with t(14;18)(q32;q21).
15593119 2005 Activation-induced cytidine deaminase fails to induce a mutator phenotype in the human pre-B cell line Nalm-6.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448152 2004 Activation-induced cytidine deaminase deaminates 5-methylcytosine in DNA and is expressed in pluripotent tissues: implications for epigenetic reprogramming.
15372234 2004 A novel activation-induced cytidine deaminase gene mutation in a Tunisian family with hyper IgM syndrome.
15371439 2004 Biochemical analysis of hypermutational targeting by wild type and mutant activation-induced cytidine deaminase.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15304391 2004 Expression of the AID protein in normal and neoplastic B cells.
15252444 2004 Activation-induced cytidine deaminase initiates immunoglobulin gene conversion and hypermutation by a common intermediate.
15195091 2004 Separate domains of AID are required for somatic hypermutation and class-switch recombination.
15182647 2003 [Correlation between activation-induced cytidine deaminase gene polymorphism and atopic asthma and plasma IgE in adult].
15148397 2004 The structure of a yeast RNA-editing deaminase provides insight into the fold and function of activation-induced deaminase and APOBEC-1.
15087440 2004 Activation-induced cytosine deaminase (AID) is actively exported out of the nucleus but retained by the induction of DNA breaks.
15061213 2004 Expression of activation-induced cytidine deaminase (AID) in Burkitt lymphoma cells: rare AID-negative cell lines with the unmutated rearranged VH gene.
14990977 2004 Activation-induced cytidine deaminase expression in follicular lymphoma: association between AID expression and ongoing mutation in FL.
14769937 2004 Activation-induced cytidine deaminase shuttles between nucleus and cytoplasm like apolipoprotein B mRNA editing catalytic polypeptide 1.
14551145 2004 Mantle cell lymphoma with t(11;14) and unmutated or mutated VH genes expresses AID and undergoes isotype switch events.
14536088 2003 C-terminal deletion of AID uncouples class switch recombination from somatic hypermutation and gene conversion.
12973929 2003 Polymorphisms of IL-4, IL-4R alpha, and AICDA genes in adult allergic asthma.
12928399 2003 The block in immunoglobulin class switch recombination caused by activation-induced cytidine deaminase deficiency occurs prior to the generation of DNA double strand breaks in switch mu region.
12873980 2003 Expression of activation-induced cytidine deaminase is confined to B-cell non-Hodgkin's lymphomas of germinal-center phenotype.
12855567 2003 Activation-induced cytidine deaminase in chronic lymphocytic leukemia B cells: expression as multiple forms in a dynamic, variably sized fraction of the clone.
12799424 2003 Human activation-induced cytidine deaminase causes transcription-dependent, strand-biased C to U deaminations.
12715918 2003 Type two hyper-IgM syndrome caused by mutation in activation-induced cytidine deaminase.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
12651944 2003 Activation-induced cytidine deaminase deaminates deoxycytidine on single-stranded DNA but requires the action of RNase.
12521993 2003 Chronic lymphocytic leukemia B cells expressing AID display dissociation between class switch recombination and somatic hypermutation.
12511417 2003 Expression of activation-induced cytidine deaminase in human B-cell non-Hodgkin lymphomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202747 2002 Somatic hypermutation of the AID transgene in B and non-B cells.
12114543 2002 Internal IgH class switch region deletions are position-independent and enhanced by AID expression.
12011459 2002 AID-GFP chimeric protein increases hypermutation of Ig genes with no evidence of nuclear localization.
11544457 2001 Association between a new polymorphism in the activation-induced cytidine deaminase gene and atopic asthma and the regulation of total serum IgE levels.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11112359 2000 Mutations in activation-induced cytidine deaminase in patients with hyper IgM syndrome.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11007475 2000 Activation-induced cytidine deaminase (AID) deficiency causes the autosomal recessive form of the Hyper-IgM syndrome (HIGM2).
10950930 2000 Isolation, tissue distribution, and chromosomal localization of the human activation-induced cytidine deaminase (AID) gene.