Property Summary

NCBI Gene PubMed Count 233
PubMed Score 1210.98
PubTator Score 729.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.9e-04

Gene RIF (210)

PMID Text
26549924 results indicated that the cis-regulatory expressional difference of AHSG is expected to occur at the level of transcription or splicing of mRNA
26464644 AHSG is up-regulated in hypopharyngeal squamous cell carcinoma may be employed as a potential biomarker for its early diagnosis
26448929 Reanalysis of a total of 47 MDS patients revealed biomarker candidates, with alpha-2-HS-glycoprotein and leucine-rich alpha-2-glycoprotein as the most promising candidates.
26426614 serum concentrations significantly associated with elevated fatty liver index, ALT, and AST, the early indicators of nonalcoholic fatty liver disease
26343871 Common variants in the AHSG gene are strongly associated with fetuin-A levels, but their concurrent association with CHD risk in current prospective studies is inconsistent
26214492 The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.
26181150 The aim of this article is to summarize, comment and order previous knowledge about Fetuin-A.
26156593 Data suggest that serum fetuin-A (FETUA/AHSG) concentrations are signi fi cantly positively associated with serum VEGFA (vascular endothelial growth factor A) levels in patients with newly diagnosed type 2 diabetes.
25978344 Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome.
25888842 These findings establish urinary Fetuin-A as a sensitive biomarker of the progression of autosomal dominant polycystic kidney disease.
25815703 The present study demonstrates that fetuin-A 742 (C/T) and 766 (C/G) genotypes may be risk factors for myocardial infarction in patients older than 40 years of age.
25695715 The T nucleotide in rs4917 of AHSG is associated with more favorable lipid status among healthy persons (i.e., lower low-density lipoprotein cholesterol) and anthropologic parameters of obesity in cohort 2.
25679296 Fetuin-A is a novel risk marker for coronary artery disease in asymptomatic young adults.
25656814 In this large sample of community-dwelling older adults, a small positive association between fetuin-A and areal BMD appeared attributable to confounding variables and we found no evidence of an association between fetuin-A and risk of clinical fracture.
25636693 Fetuin-A has a potent role in calcification process of choroid plexus.
25627311 Circulating fetuin-A could be a useful serum biomarker for predicting liver and vascular fibrosis progression in fatty liver disease patients.
25611809 The findings of our study indicate a modest linear association between fetuin-A concentrations and risk of colorectal cancer but suggest that fetuin-A may not be causally related to colorectal cancer development
25491620 Elevated levels of serum and fetuin-A were associated with severity of psoriasis.
25252441 Mean value of fetuin-A was similar in controls and osteosarcoma children and adolescents after treatment.
25196492 Serum Fetuin-A level is closely correlated with osteoporosis and it may serve as a predictor of osteoporosis in maintenance hemodialysis patients
25194507 Was accelerated significantly in the presence of either endogenous fetuin-A.
25110104 High plasma fetuin-A levels are associated with metabolic syndrome.
25106788 results strongly suggest that the presence of serum autoantibodies against AHSG protein may be useful as serum biomarkers for early-stage breast cancer screening and minimally invasive diagnosis in Mexican populations.
25011927 Data indicate that the effect of testosterone on fetuin-A (alpha-2-HS-glycoprotein, AHSG) mRNA levels was abrogated by silencing of the androgen receptor in HepG2 cells.
24969186 A low level of fetuin-A seems to be associated with atherosclerosis, inflammation and malnutrition in hemodialysis patients.
24797980 Serum fetuin A concentration is elevated in children with non-alcoholic fatty liver disease.
24643166 Serum adiponectin and fetuin-A, independently of each other, associate with type 2 diabetes mellitus risk.
24618180 Alpha-2-HS-glycoprotein precursor and tubulin beta chain could be involved in the pathogenesis of Colorectal cancer
24570294 The study suggested evidence of a causal relationship between the AHSG gene and bone mineral density through fetuin-A and BMI mediators.
24493202 Fetuin-A and/or palmitate influence the expression of proinflammatory and angiogenic proteins only partially via TLR4 signalling
24487480 Decreased serum fetuin-A levels are independently associated with disease activity in patients with Crohn's disease and ulcerative colitis.
24366942 Plasma fetuin-A levels were approximately 20% lower in hypothyroid female patients compared with the controls. Fetuin-A levels increased by approximately 20% in hypothyroid patients after achievement of euthyroidism.
24332981 Endogenously produced AHSG in an head and neck squamous cell carcinoma cell line, promotes in vitro cellular properties identified as having a role in tumorigenesis.
24325554 Fetuin-A may serve as a biological link between vascular disease and normal age-related cognitive decline.
24307429 Compared with healthy control subjects, patients with coronary artery disease had higher serum levels of fetuin-A.
24165691 expression of fetuin-A in the serum, urine and renal tissue of patients with or without nephrolithiasis
24143207 Fetuin-A is demonstrated as a risk factor for both microalbuminuria and reduction of GFR in diabetic nephropathy
24140093 Elevated serum fetuin-A but lower adiponectin and free leptin are associated with higher risk of myelodysplastic syndrome
24088332 Within the context of rhTSH administration for surveillance of thyroid cancer recurrence, there was no effect on serum levels of fetuin-A.
23961784 results suggest that Fetuin-A may have a role in triggering the processes leading to insulin resistance and androgen excess in polycystic ovary syndrome
23943623 lipid-induced FetA from adipocytes is an efficient chemokine for macrophage migration and polarization
23933250 The study demonstrated, using similar concentration range of fetuin-A found in blood, that it robustly supports both directed chemo-attraction and invasion of breast tumor cells.
23925820 Fetuin-A might be a novel indicator of disease activity in patients with familial Mediterranean fever (FMF) and could be used as an adjunctive marker for differentiation of FMF attacks.
23925572 Migraine patients have low fetuin-A levels, which may be related to the pathogenesis of migraine; to the best of the authors' knowledge, this is the first clinical study that demonstrated an association between fetuin-A and migraine
23907641 findings suggest that rs4918 SNPs of the AHSG gene are associated with a risk for ischemic stroke in a Northern Han Chinese population
23852792 Metabolic syndrome patients with microalbuminuria had high levels of fetuin-A and cystatin-C
23811603 levels of serum fetuin-A are significantly associated with insulin resistance and arterial stiffness
23801724 Common variants in the AHSG gene are strongly associated with plasma fetuin-A concentrations, but not with risk of type 2 diabetes or glucose concentrations.
23799555 There are increased carotid intima-media thickness values, decreased fetuin-A levels, but unchanged ABI values in patients with normotensive COPD.
23795812 Serum fetuin-A is inversely related to severity of coronary artery disease.
23765754 serum level of fetuin A is high in morbidly obese subjects and is negatively associated with 8-hydroxydeoxyguanosine level in peripheral circulation.
23758931 In chronic hemodialysis patients both fetuin-A (and osteoprotegerin) levels are independently associated with arterial stiffness but not atherosclerosis.
23719603 results suggest that Complement C3 and AHSG might be the potential tumor markers in pancreatic ductal adenocarcinoma screening and diagnosis
23627434 Data indicate that fetuin-A expression is more prominent in NASH (non-alcoholic steatohepatitis).
23600632 This prospective cross-sectional study demonstrates high fetuin-A levels to be independently associated with NAFLD and a lower risk of coronarographically diagnosed CAD.
23577176 Fetuin-A-containing calciprotein particles reduce mineral stress in the macrophage
23439582 Our results show that CSF fetuin-A is a biomarker of disease activity and natalizumab response in multiple sclerosis
23433744 fetuin-A concentrations were increased in euglycemic patients with polycystic ovary syndrome.
23418544 Data indicate that five important proteins, vimentin, gelsolin, alpha 2 HS glycoprotein (AHSG), glial fibrillary acidic protein (GFAP), and alpha1B-glycoprotein (A1BG) were expressed higher in Rheumatoid arthritis (RA) synovial fluid than non-RA samples.
23231493 Report serum fetuin-A concentrations acorss the spectrum of chronic kidney disease.
23190703 In Chinese adults, a positive correlation was found between chronic hyperglycemia and serum fetuin-A levels
23109215 Fetuin-A was found in cortex, white matter, subplate, hippocampus, subventricular zone, & ependymal cells which supports a global role for brain function.
23066960 serum fetuin-A levels were negatively and independently correlated with symptomatic and radiographic severity of the disease in patients with primary knee osteoarthritis.
23056292 glycosylation studies showed the reduced N-linked sialylation of A2HSG in RA patients. Altered glycoprotein expression and functional as well as structural studies of glycans might help in the diagnosis of RA and understanding the disease pathogenesis
23024326 Circulating fetuin-A levels are decreased in patients with obstructive sleep apnea syndrome (OSAS) and are associated with OSAS severity. Fetuin-A could a contributing factor for the development of cardiovascular complications in OSAS patients.
22980907 mechanisms by which fetuin-A mediates the adhesion of tumor cells
22855337 Circulating levels of fetuin-A, RBP4, and FABP4 are associated with insulin resistance and with distinct components of metabolic syndrome consistent with the multifactorial pathogenesis of metabolic dysregulation.
22820893 we aimed to focus on roles of fetuin-A and angiopoietins and to highlight the most plausible mechanisms that might explain their associations with type 2 DM and obesity--{REVIEW}
22815691 Serum fetuin A levels were higher in prevalent hepatic steatosis patients with hepatic steatosis, and positively correlated with chemerin levels
22685600 Data indicate that in the disease group, leptin, leptin/adiponectin ratio, fetuin-A and retinol-binding protein 4 (RBP4) levels were remarkably lower than in the no-symptom group
22619360 ER stress induced by high glucose and palmitate increases the expression of fetuin-A and further contributes to the development of insulin resistance
22554599 Low fetuin-A levels predicted greater risk for CVD mortality in older adults without diabetes, but were associated with reduced risk of CVD death in those with diabetes
22546644 Data show that serum Fetuin-A concentration was significantly higher in the hemodialysis (HD) compared to renal transplant (RT) group.
22511752 Higher fetuin-A is associated with incident diabetes mellitus in older persons regardless of sex, race, or prevalent cardiovascular disease status.
22489108 Lower levels of fetuin A in trisomy 21 may indicate an association with altered metabolic pathways in this early stage that could potentially be associated with features of the syndrome, such as growth restriction or impaired osteogenesis.
22425942 Serum Fetuin A (AHSG) increases with age; long-lived elder individuals and subjects with the TS or SS AHSG polymorphisms have lower levels of the circulating protein.
22387701 At the early stage of weight gain fetuin-A could be of relevance for the development of insulin resistance.
22377528 Fetuin-A is inversely associated with CAC severity among community-living individuals without CVD.
22196954 Soluble CD40 ligand, high sensitive C-reactive protein and fetuin-A levels in patients with essential thrombocythemia.
22170794 Fetuin A levels are elevated in nonalcoholic fatty liver disease; hepatic expression of fetuin A correlates with key enzymes in glucose and lipid metabolism.
22115341 The change in serum fetuin-A, matrix Gla protein (MGP), and osteopontin (OPN) levels after intracerebral hemorrhage (ICH) indicates that these parameters play a role in the pathophysiological processes leading to an ICH.
22101880 Carriers of the Thr248Thr genotype of AHSG showed a higher benefit from the lifestyle intervention
22024217 Haplotypes derived from these AHSG variants also were not significantly associated with coronary lesions. Further, no significant associations between investigated SNPs and the extent or severity of CAD could be observed
21958193 Results suggest an independent association of fetuin-A levels with markers of bone turnover in male and female patients with type 2 diabetes.
21953030 report abundance levels of AHSG in serum samples from patients with advanced breast cancer, colorectal cancer (CRC) and lung cancer compared to healthy controls (age and gender matched) using commercially available enzyme-linked immunosorbent assay kits
21904596 Study has demonstrated that the AA genotype of rs2268690, which leads to a higher AHSG serum concentration, was significantly associated with protection against SARS development.
21893974 serum fetuin-A in nephrotic children may be a consequence of proteinuria
21804488 Serum fetuin-A levels inversely correlate with the severity of atherosclerosis in nonuremic patients with symptomatic chronic lower limb ischemia.
21659653 Fetuin-A deficiency is associated with soft tissue calcification in mice and humans.
21613794 Pretransplant levels of fetuin-A are not a predictor for renal allograft loss or rejection episodes after 36 months' follow-up in transplant recipients.
21543017 Time-averaged fetuin-A was associated with survival and cardiovascular outcome, independent of vascular calcification.
21521346 fetuin-A levels were not changed significantly after a 3-month combined exercise programme in obese Korean women.
21521338 Impaired glucose tolerance and newly diagnosed type 2 diabetes are positively associated with serum fetuin-A concentrations in subjects without nonalcoholic fatty liver disease independent of cardiometabolic risk factors.
21383631 low fetuin-A levels may have a role in impaired coronary flow in STEMI patients undergoing primary percutaneous coronary intervention
21310413 Serum fetuin-A levels were strongly and independently associated with metabolic syndrome and its components in community-dwelling Chinese adults.
21253869 Data suggest that dynamic changes in the serum level of alpha-2-HS-glycoprotein may be a potential early marker for predicting HBeAg seroconversion during IFN treatment for chronic hepatitis B.
21123340 Data suggest a potential role for fetuin-A in microvascular involvement of systemic sclerosis.
21085476 Data show that comparing to T2D the IFG subjects had higher serum chemerin, progranulin, fetuin-A and RBP4 levels which was not detectable in the comparison of the T2D and IGT group.
20964498 Serum fetuin-A showed important association with coronary, valvular calcification and inflammation in hemodialysis patients.
20963400 serum fetuin-A was significantly associated with L2-4 bone mineral density in elderly women
20956534 Fetuin-A ({alpha}2HS-glycoprotein) is a major serum adhesive protein that mediates growth signaling in breast tumor cells
20946008 Serum fetuin-A concentration was not associated with measures of insulin resistance or with preclinical atherosclerosis in Hispanics and non-hispanic whites.
20929991 Fetuin-A was higher in type 2 diabetes-peripheral arterial disease patients than in type 2 diabetes-non-PAD patients.
20926473 Serum AHSG levels are significantly increased in adult patients with biopsy-proven non-alcoholic fatty liver disease and are associated with insulin resistance.
20806899 Fetuin-A inhibition of meprin alpha activity was 40 times weaker than that of meprin beta activity.
20713686 Higher serum fetuin-A was associated with abnormal albuminuria independent of BMI, waist circumference, blood pressure, and other determinants of albuminuria in middle-aged and elderly Chinese women with NGT.
20660040 Fetuin-A is markedly increased in patients with morbid obesity. The reduction of Fetuin-A after weight loss could play an important role in the beneficial effects of gastric bypass surgery.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605840 Low levels of circulating fetuin-A are associated with increased mortality in dialysis patients.
20605840 Observational study of gene-disease association. (HuGE Navigator)
20576822 In a relatively young population with mild-to-moderate alteration of kidney function anomalies of the serum FGF 23/fetuin A levels appear early in the course of disease and are independent major predictors for extent of coronary artery disease.
20575466 Fetuin A level monitoring is potentially a new marker for non-invasive and accurate prediction status for the hospitalization of patients with acute pancreatitis.
20546343 fetuin-A in calcified carotid atheroma
20543523 serum fetuin-A levels constitute an independent marker of insulin resistance and an atherogenic lipid profile in Japanese men
20533272 The rs2248690 SNP in the promoter region of the AHSG gene might affect the AHSG gene transcription.
20533272 Observational study of gene-disease association. (HuGE Navigator)
20501379 Reduced serum fetuin A may be a potential risk factor of coronary artery calcification, and can contribute to cardiovascular events in patients starting hemodialysis.
20496312 data provide evidence against a major role of exercise in the regulation of serum fetuin-A levels in non-diabetic obese women
20453496 study showed an association between AHSG polymorphism and its serum concentration, and also revealed an association of the serum fetuin-A level
20453496 Observational study of gene-disease association. (HuGE Navigator)
20436350 Serum fetuin-A levels inversely correlated with advanced calcified coronary artery disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374388 Fetuin-A and IL-18 levels seem to be increased in ankylosing spondylitis patients regardless of disease activity and treatment type.
20299368 Observational study of gene-disease association. (HuGE Navigator)
20199782 Plasma levels of fetuin-A were significantly higher in both young and older low-activity men as compared with levels in their high-active counterparts, and fetuin-A was inversely related to maximal oxygen uptake.
20150538 mechanisms common to chronic kidney disease and fatty liver are linked through an interorgan communication orchestrated by fetuin-A and adiponectin
20091488 Fetuin-A concentration decreased in parallel with the increase in ET-1 and IL-6 levels as renal function declined in chronic kidney disease.
20031641 AHSG tagging single-nucleotide polymorphisms were associated with fetuin-A plasma levels and cardiovascular diseases.
20031641 Observational study of gene-disease association. (HuGE Navigator)
20019453 Plasma levels do not correlate with coronary calcification.
20015522 These results suggest that fetuin-A may inhibit the calcification of atherosclerotic plaques independently of the dialyzed condition
19931899 the patients with fetuin-A c.766C > G gene polymorphism may be at higher risk for renal calcium oxalate stone formation
19931899 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910501 Potentially unique role for fetuin-A deficiency as a biomarker of peripheral arterial disease in patients with type 2 diabetes.
19896717 Recombinant hyaluronidases and the high abundance serum component alpha-2HS-glycoprotein, could be obtained with authentic glycosylation while circumventing alpha-1,3-core fucose addition, which is the hallmark of cross-reactive carbohydrate determinants.
19862540 levels in intrahepatic cholestasis of pregnancy not different from controls
19857676 Observational study of gene-disease association. (HuGE Navigator)
19857655 Observational study of gene-disease association. (HuGE Navigator)
19681840 Study demonstrates an association between serum fetuin-A levels, coronary artery calcification, and bone mineral densities in maintenance hemodialysis patients.
19672022 D-glucose, but not L-glucose or mannitol, dose-dependently enhanced AHSG promoter activity through activation of the ERK1/2 signaling pathway
19615685 Letter: High plasma fetuin-A is associated with early changes in the carotid artery in patients at risk for diabetes and/or cardiovascular disease.
19602903 The acceleration of arterial wall stiffness in CKD is associated with additional factors, i.e. fetuin A deficiency and higher CRP and IL-6.
19478814 serum AHSG concentration is decreased and reflects-at least partly-systemic inflammation in preeclampsia
19453261 Observational study of gene-disease association. (HuGE Navigator)
19358088 Observational study of gene-disease association. (HuGE Navigator)
19194829 fetuin recognized by anti-LY-R antibodies is an immunogenic form associated only with the tumorigenic LY-R cells and might be involved in tumor progression in this lymphoma.
19151998 We have investigated the synthesis and localization of fetuin-A and MGP in bone of hemodialysis patients
19110009 FETUA and arterial stiffness in patients with normal kidney function is described.
19031279 Serum fetuin-A concentrations do not differ between intrauterine-growth-restricted cases and appropriate-for-gestational-age controls.
19029462 link between high plasma fetuin-A levels and an increased risk of myocardial infarction and ischemic stroke
19016589 Higher fetuin-A levels are independently associated with higher bone mineral density among well-functioning community-dwelling older women but not older men.
18728159 Fetuin-A levels are higher in obese children with non-alcoholic fatty liver disease, and are related to insulin resistance and to features of metabolic syndrome X in both cross-sectional and longitudinal analyses
18633113 Data suggest that fetuin-A is an independent risk factor of type 2 diabetes.
18612115 Among well-functioning older persons, serum fetuin-A is associated with incident diabetes mellitus, independent of other markers of insulin resistance.
18364352 fetuin-A and other acidic bulk plasma proteins may be considered as mineral chaperones mediating the stabilization, safe transport, and clearance in the body of calcium and phosphate as colloidal complexes, thus, preventing ectopic calcification
18337634 Observational study of gene-disease association. (HuGE Navigator)
18335040 provide novel evidence that the secreted liver protein fetuin-A induces low-grade inflammation and represses adiponectin production in animals and in humans
18334823 These data in a selected cohort of CKD patients indicate that fetuin-A may be one of the contributing factors for the development of endothelial dysfunction in CKD patients.
18316360 Common variations in AHSG may contribute to the interindividual variation in metabolic traits in type 2 diabetes and dyslipidemia.
18316360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18286307 Circulating levels of MGP and fetuin-A could not be identified as independent predictors of vascular stiffness or other carotid artery parameters in pediatric renal transplant recipients.
18281421 Serum AHSG concentration, measured before starting treatment, predicts survival in patients with glioblastoma.
18089450 In hemodialysis patients, lower fetuin-A concentrations were associated with increases in both cardiovascular and overall mortality.
18085392 Low fetuin-A level is a useful predictor of malnutrition and inflammation, as well as being a useful predictor of the cardiac failure caused by an increased ventricular load in hemodialysis patients.
18065755 Prominent defects in glycosylation/sialylation of fetuin-A revealed by this study might be responsible for impaired function of fetuin-A, leading to deficient fetal growth.
17960182 FETUA may contribute to scarless wound healing
17889958 A single nucleotide polymorphism in the promoter affects AHSG gene transcription, possibly by producing different association with AP-1.
17882149 Serum fetuin-A levels are not related to all-cause or cardiovascular mortality among persons with predominantly non-diabetic stage 3 or 4 chronic kidney disease.
17851232 Observational study of gene-disease association. (HuGE Navigator)
17851232 CKD patients on hemodialysis have similar the reduction in serum fetuin-A levels in Italian HD patients is not associated with an alteration in the distribution of AHSG T256S polymorphisms.
17702860 Fetuin-A is an important predictor of death at 6 months in STEMI patients independent of NT-proBNP, CRP, and CADILLAC risk score.
17611637 Role of fetuin-A in the pathogenesis calcific aortic valve stenosis independently of the renal function.
17557141 Observational study of gene-disease association. (HuGE Navigator)
17557141 Finds polymorphisms in the AHSG gene may have effects on BMD variation in spine and hip of Caucasian population suggesting possible effects on osteoporosis.
17318070 low serum fetuin A levels in chronic kidney disease (CKD) may contribute to impaired endothelial functions in CKD
17303000 the AHSG gene may be linked to bone geometry in Caucasians, but not in Chinese
17303000 Observational study of gene-disease association. (HuGE Navigator)
17062776 Observational study of gene-disease association. (HuGE Navigator)
17010978 alpha2-Heremans-Schmid glycoprotein/fetuin may have a role in atherosclerotic vascular disease and low bone mass
16968979 There is an independent and significant association between reduced serum fetuin-A levels and multi-site cardiovascular calcification in hemodialysis.
16898488 Fetuin A, 59 kDa protein, produced in the liver is a circulating inhibitor of vascular calcification
16567568 A total of 45% of participants (80 of 177) in the highest quartile of fetuin-A had metabolic syndrome X compared with 24% of participants (42 of 177) in the lowest quartile.
16318278 Observational study of gene-disease association. (HuGE Navigator)
16117875 Observational study of gene-disease association. (HuGE Navigator)
16113307 Fetuin-A is necessary for a robust infection by malarial sporozoites; its interaction with P. berghei thrombospondin-related adhesive protein (TRAP) enhances the parasite's ability to invade human hepatocytes in vitro
16046317 Observational study of gene-disease association. (HuGE Navigator)
16046317 major allele of a synonymous coding single nucleotide polymorphism (SNP) in exon 7 of alpha2-Heremans-Schmid glycoprotein (AHSG)presented significant evidence of association with type 2 diabetes
16024912 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16024912 We conclude that a common variation (Thr230Met) in the AHSG gene is associated with a marked increase in beta2-adrenoceptor sensitivity in subcutaneous fat cells, which may be of importance in body weight regulation.
16002217 Observational study of gene-disease association. (HuGE Navigator)
16002217 These results suggest that the AHSG gene polymorphism may be associated with late-onset Alzheimer disease in Italians. Additional studies are warranted to examine the biological relevance of AHSG in neurodegenerative disorders.
15931001 Deficiencies of calcification inhibitors such as fetuin-A are relevant pathomechanisms in the progression of uncontrolled vascular calcification and may offer potential for future therapeutic approaches.
15917161 Observational study of gene-disease association. (HuGE Navigator)
15882283 Observational study of gene-disease association. (HuGE Navigator)
15806395 Observational study of gene-disease association. (HuGE Navigator)
15806395 common variant of AHSG, previously associated with a lower AHSG protein level, is more common among lean than obese and overweight men, supporting the results from Ahsg knock-out mice, namely, that AHSG modulates body mass
15599699 Observational study of gene-disease association. (HuGE Navigator)
15599699 This protein is associated with insulin-mediated inhibition of lipolysis.
15592877 Observational study of gene-disease association. (HuGE Navigator)
15592877 AHSG levels demonstrated a significant negative correlation with free phosphate levels (P<0.001), indicating that AHSG is a novel determinant of serum phosphate.
15589849 Observational study of gene-disease association. (HuGE Navigator)
15589849 Proportion of noncarriers of AHSG 2 allele significantly higher in women with endometriosis than in women without. Women not carrying AHSG 2 allele were found to have twice the risk of endometriosis than those carrying at least one copy of this allele.
14667137 Our data provided no evidence to support the AHSG gene as a quantitative trait locus (QTL) for the bone mineral density (BMD) variation in a Chinese population.
12914574 Observational study of genotype prevalence. (HuGE Navigator)
12556469 This protein inhibits calcification by inhibiting the formation of colloidal calcium-protein particles.
12207096 REVIEW: an important inhibitor of pathologic calcification, and deficiency contributes to pathogenesis of cardiovascular calcifications in dialysis patients.
12153747 AHSG, TNF-alpha and leptin may contribute to insulin resistance during normal pregnancy and gestational diabetes
12153747 AHSG along with these cytokines may also negatively regulate neonatal skeletal development.
11922920 Plasma alpha2-HS glycoprotein concentrations in patients with acute myocardial infarction quantified by a modified ELISA.

AA Sequence

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP      1 - 70
QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE     71 - 140
DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA    141 - 210
KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS    211 - 280
PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA    281 - 350
AGPVVPPCPGRIRHFKV                                                         351 - 367
//

Text Mined References (246)

PMID Year Title
26549924 2015 Allelic Imbalance of mRNA Associated with ?2-HS Glycoprotein (Fetuin-A) Polymorphism.
26464644 2015 Proteomic identification of alpha-2-HS-glycoprotein as a plasma biomarker of hypopharyngeal squamous cell carcinoma.
26448929 2015 Plasma Protein Biomarker Candidates for Myelodysplastic Syndrome Subgroups.
26426614 2015 Serum Fetuin-A Associated With Fatty Liver Index, Early Indicator of Nonalcoholic Fatty Liver Disease: A Strobe-Compliant Article.
26343871 2015 Fetuin-A and risk of coronary heart disease: A Mendelian randomization analysis and a pooled analysis of AHSG genetic variants in 7 prospective studies.
26214492 2015 Correlation of plasma soluble cluster of differentiation 40 ligand, alpha fetoprotein A, and pregnancy-associated plasma protein A with carotid plaque in patients with ischemic stroke.
26181150 2015 [Fetuin-A and its role in important processes in organism. From nanobacteries to nanoparticles. Attempt to summarize available information].
26156593 2015 Serum fetuin-A concentrations are positively associated with serum VEGF levels in patients with newly diagnosed type 2 diabetes.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25978344 2015 Increased adipose tissue secretion of Fetuin-A, lipopolysaccharide-binding protein and high-mobility group box protein 1 in metabolic syndrome.
25888842 2015 Urine Fetuin-A is a biomarker of autosomal dominant polycystic kidney disease progression.
25815703 2015 Fetuin-A 742 (C/T) and 766 (C/G) polymorphic sites are associated with increased risk of myocardial infarction in older patients (? 40 years of age).
25695715 2015 Association of human fetuin-A rs4917 polymorphism with obesity in 2 cohorts.
25679296 2015 Associations of fibroblast growth factor 23 and fetuin-A with coronary plaque burden and plaque composition in young adults.
25656814 2015 Association of Fetuin-A With Incident Fractures in Community-Dwelling Older Adults: The Cardiovascular Health Study.
25636693 2015 Serum fetuin-A levels in subjects with and without choroid plexus calcification.
25627311 2015 Fetuin-A negatively correlates with liver and vascular fibrosis in nonalcoholic fatty liver disease subjects.
25611809 2015 Plasma fetuin-A concentration, genetic variation in the AHSG gene and risk of colorectal cancer.
25491620 2014 The levels of serum pentraxin3, CRP, fetuin-A, and insulin in patients with psoriasis.
25252441 2014 [Assessment of anthropometric parameters and serum leptin and fetuin-A levels in children and adolescents with osteosarcoma after anticancer treatment].
25196492 2014 Effect of serum fibroblast growth factor-23, matrix Gla protein and Fetuin-A in predicting osteoporosis in maintenance hemodialysis patients.
25194507 2014 Fetuin-A associates with histones intracellularly and shuttles them to exosomes to promote focal adhesion assembly resulting in rapid adhesion and spreading in breast carcinoma cells.
25110104 2014 High plasma fetuin-A levels are associated with metabolic syndrome among males but not females in a Japanese general population.
25106788 2015 Alpha 2HS-glycoprotein, a tumor-associated antigen (TAA) detected in Mexican patients with early-stage breast cancer.
25011927 2014 Up-regulation of hepatic alpha-2-HS-glycoprotein transcription by testosterone via androgen receptor activation.
24969186 2014 Association of serum fetuin-A and biochemical parameters in hemodialysis patients.
24797980 2014 Serum fetuin A concentration is elevated in children with non-alcoholic fatty liver disease.
24643166 2014 Impact of the adipokine adiponectin and the hepatokine fetuin-A on the development of type 2 diabetes: prospective cohort- and cross-sectional phenotyping studies.
24618180 2014 Identification alpha-2-HS-glycoprotein precursor and tubulin beta chain as serology diagnosis biomarker of colorectal cancer.
24570294 2014 Causal relationship between the AHSG gene and BMD through fetuin-A and BMI: multiple mediation analysis.
24493202 2014 Fetuin-A influences vascular cell growth and production of proinflammatory and angiogenic proteins by human perivascular fat cells.
24487480 2014 Decreased serum fetuin-A levels and active inflammatory bowel disease.
24366942 2014 Plasma fetuin-A levels are reduced in patients with hypothyroidism.
24332981 2014 Alpha-2 Heremans Schmid Glycoprotein (AHSG) modulates signaling pathways in head and neck squamous cell carcinoma cell line SQ20B.
24325554 2014 Fetuin-A, a new vascular biomarker of cognitive decline in older adults.
24307429 2014 Serum levels of fetuin-A, osteoprotegerin and osteopontin in patients with coronary artery disease: effects of statin (HMGCoA-reductase inhibitor) therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165691 2014 Patients with nephrolithiasis had lower fetuin-A protein level in urine and renal tissue.
24143207 2013 Urinary fetuin-A is a novel marker for diabetic nephropathy in type 2 diabetes identified by lectin microarray.
24140093 2013 Higher fetuin-A, lower adiponectin and free leptin levels mediate effects of excess body weight on insulin resistance and risk for myelodysplastic syndrome.
24088332 2013 Serum fetuin-A levels following recombinant human thyroid-stimulating hormone stimulation.
23961784 2013 Serum Fetuin-A levels, insulin resistance and oxidative stress in women with polycystic ovary syndrome.
23943623 2013 Adipocyte fetuin-A contributes to macrophage migration into adipose tissue and polarization of macrophages.
23933250 2013 Fetuin-A (?2HS-glycoprotein) is a serum chemo-attractant that also promotes invasion of tumor cells through Matrigel.
23925820 2013 Can serum fetuin-A be regarded as an inflammatory marker among patients with familial Mediterranean fever?
23925572 2014 Low fetuin-A level in migraine: a case-control study.
23907641 2013 Association of AHSG gene polymorphisms with ischemic stroke in a Han Chinese population.
23852792 2013 The relationship between serum fetuin-A, cystatin-C levels, and microalbuminuria in patients with metabolic syndrome.
23811603 2013 Associations of serum fetuin-A levels with insulin resistance and vascular complications in patients with type 2 diabetes.
23801724 2013 Genetically elevated fetuin-A levels, fasting glucose levels, and risk of type 2 diabetes: the cardiovascular health study.
23799555 2014 Serum fetuin-A levels are associated with carotid intima-media thickness in patients with normotensive chronic obstructive pulmonary disease.
23795812 2013 Relation between fetuin-A levels and fibroblast growth factor 23 with the severity of coronary artery disease measured by SYNTAX scores.
23765754 2013 Serum levels of fetuin A and 8-hydroxydeoxyguanosine in morbidly obese subjects.
23758931 2013 Associations of fetuin-A and osteoprotegerin with arterial stiffness and early atherosclerosis in chronic hemodialysis patients.
23719603 Profiling the potential tumor markers of pancreatic ductal adenocarcinoma using 2D-DIGE and MALDI-TOF-MS: up-regulation of Complement C3 and alpha-2-HS-glycoprotein.
23627434 2013 Fetuin-A mRNA expression is elevated in NASH compared with NAFL patients.
23600632 2013 Relationship of serum fetuin-A levels with coronary atherosclerotic burden and NAFLD in patients undergoing elective coronary angiography.
23577176 2013 Fetuin-A-containing calciprotein particles reduce mineral stress in the macrophage.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23439582 2013 Cerebrospinal fluid fetuin-A is a biomarker of active multiple sclerosis.
23433744 2013 The serum protein ?2-Heremans-Schmid glycoprotein/fetuin-a concentration and carotid intima-media thickness in women with polycystic ovary syndrome.
23418544 2013 Identification of novel autoantigen in the synovial fluid of rheumatoid arthritis patients using an immunoproteomics approach.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23231493 2013 Serum fetuin-A concentration and fetuin-A-containing calciprotein particles in patients with chronic inflammatory disease and renal failure.
23190703 2012 Positive correlation between chronic hyperglycemia and serum fetuin-A levels in middle-aged and elderly Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23109215 2013 Fetuin-a in the developing brain.
23066960 2013 Serum fetuin-A levels are inversely associated with clinical severity in patients with primary knee osteoarthritis.
23056292 2012 Jacalin bound plasma O-glycoproteome and reduced sialylation of alpha 2-HS glycoprotein (A2HSG) in rheumatoid arthritis patients.
23024326 2012 Reduced plasma fetuin-A levels in patients with obstructive sleep apnoea.
22980907 2012 Fetuin-A triggers the secretion of a novel set of exosomes in detached tumor cells that mediate their adhesion and spreading.
22855337 2012 Cardiometabolic correlates and heritability of fetuin-A, retinol-binding protein 4, and fatty-acid binding protein 4 in the Framingham Heart Study.
22820893 2012 Fetuin-A and angiopoietins in obesity and type 2 diabetes mellitus.
22815691 2012 Serum fetuin A and chemerin levels correlate with hepatic steatosis and regional adiposity in maintenance hemodialysis patients.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22685600 2012 Circulating levels of adiponectin, leptin, fetuin-A and retinol-binding protein in patients with tuberculosis: markers of metabolism and inflammation.
22619360 2012 Endoplasmic reticulum stress induces the expression of fetuin-A to develop insulin resistance.
22554599 2012 The association of fetuin-A with cardiovascular disease mortality in older community-dwelling adults: the Rancho Bernardo study.
22546644 2012 Serum Fetuin-A and Pentraxin3 in hemodialysis and renal transplant patients.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22511752 2012 Association of fetuin-a with incident diabetes mellitus in community-living older adults: the cardiovascular health study.
22489108 2012 Fetuin A concentration in the second trimester amniotic fluid of fetuses with trisomy 21 appears to be lower: phenotypic considerations.
22425942 2012 Fetuin-A serum levels are not correlated to kidney function in long-lived subjects.
22387701 2012 Relationship of fetuin-A levels to weight-dependent insulin resistance and type 2 diabetes mellitus.
22377528 2012 Fetuin-A is inversely associated with coronary artery calcification in community-living persons: the Multi-Ethnic Study of Atherosclerosis.
22196954 2012 Soluble CD40 ligand, high sensitive C-reactive protein and fetuin-A levels in patients with essential thrombocythemia.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22170794 2012 Fetuin A in nonalcoholic fatty liver disease: in vivo and in vitro studies.
22115341 2012 Serum levels of calcification inhibitors in patients with intracerebral hemorrhage.
22101880 2011 An AHSG gene variant modulates basal metabolic rate and body composition development after a short-time lifestyle intervention.
22024217 2012 Are AHSG polymorphisms directly associated with coronary atherosclerosis?
21958193 2012 Levels of fetuin-A relate to the levels of bone turnover biomarkers in male and female patients with type 2 diabetes.
21953030 2012 Analysis of acute-phase proteins, AHSG, C3, CLI, HP and SAA, reveals distinctive expression patterns associated with breast, colorectal and lung cancer.
21904596 2011 Genetic variation of the human ?-2-Heremans-Schmid glycoprotein (AHSG) gene associated with the risk of SARS-CoV infection.
21893974 2011 Reduced serum fetuin-A in nephrotic children: a consequence of proteinuria?
21804488 2011 Serum fetuin-A levels inversely correlate with the severity of arterial calcification in patients with chronic lower extremity atherosclerosis without renal disease.
21659653 2011 Fetuin-A regulation of calcified matrix metabolism.
21613794 2011 Fetuin-A pretransplant serum levels, kidney allograft function and rejection episodes: a 3-year posttransplantation follow-up.
21543017 2011 Fetuin-A, coronary artery calcification and outcome in maintenance hemodialysis patients.
21521346 2011 Effects of a three-month combined exercise programme on fibroblast growth factor 21 and fetuin-A levels and arterial stiffness in obese women.
21521338 2011 Serum fetuin-A concentrations are elevated in subjects with impaired glucose tolerance and newly diagnosed type 2 diabetes.
21383631 2011 Lower fetuin-A predicts angiographic impaired reperfusion and mortality in ST-elevation myocardial infarction.
21310413 2011 Serum fetuin-A is correlated with metabolic syndrome in middle-aged and elderly Chinese.
21269460 2011 Initial characterization of the human central proteome.
21253869 2011 ?-2-HS-glycoprotein is a potential marker predicting hepatitis B e antigen seroconversion in patients with chronic hepatitis B during treatment with pegylated interferon alpha-2b.
21123340 2010 Role of fetuin-A in systemic sclerosis-associated calcinosis.
21085476 2010 Adipokine pattern in subjects with impaired fasting glucose and impaired glucose tolerance in comparison to normal glucose tolerance and diabetes.
20964498 2010 Association of fetuin-A and cardiac calcification and inflammation levels in hemodialysis patients.
20963400 2011 The relationship of fetuin-A and lactoferrin with bone mass in elderly women.
20956534 2010 Fetuin-A ({alpha}2HS-glycoprotein) is a major serum adhesive protein that mediates growth signaling in breast tumor cells.
20946008 2011 Fetuin-A does not explain ethnic disparity in cardiometabolic risk factors and subclinical atherosclerosis between Hispanics and non-Hispanic whites.
20929991 2011 Fetuin-A levels are increased in patients with type 2 diabetes and peripheral arterial disease.
20926473 2010 Serum fetuin A/?2HS-glycoprotein levels in patients with non-alcoholic fatty liver disease: relation with liver fibrosis.
20806899 2010 Fetuin-A and cystatin C are endogenous inhibitors of human meprin metalloproteases.
20713686 2010 Association between higher serum fetuin-A concentrations and abnormal albuminuria in middle-aged and elderly chinese with normal glucose tolerance.
20660040 2010 Elevated Fetuin-A concentrations in morbid obesity decrease after dramatic weight loss.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605840 2011 Is fetuin-A a mortality risk factor in dialysis patients or a mere risk marker? A Mendelian randomization approach.
20576822 2010 Fibroblast growth factor 23 and fetuin A are independent predictors for the coronary artery disease extent in mild chronic kidney disease.
20575466 2010 Serum fetuin A concentrations in patients with acute pancreatitis.
20546343 2010 Fibroblast growth factor (FGF)-23 and fetuin-A in calcified carotid atheroma.
20543523 2010 Serum fetuin-A is an independent marker of insulin resistance in Japanese men.
20533272 2010 [Association of alpha 2-Heremans-Schmid glycoprotein gene polymorphisms with its serum levels].
20501379 2010 [Low serum fetuin A is a risk factor of coronary artery calcification in patients starting hemodialysis].
20496312 2010 The effect of 6-weeks of aerobic exercise training on serum fetuin-A levels in non-diabetic obese women.
20453496 2010 Association of AHSG gene polymorphisms and aortic stiffness in peritoneal dialysis patients.
20436350 2010 Fetuin-A is associated with calcified coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374388 2010 Fetuin-A and interleukin-18 levels in ankylosing spondylitis.
20299368 2010 Examination of association with candidate genes for diabetic nephropathy in a Mexican American population.
20199782 2011 Plasma fetuin-A concentrations in young and older high- and low-active men.
20150538 2010 Mechanisms linking obesity, chronic kidney disease, and fatty liver disease: the roles of fetuin-A, adiponectin, and AMPK.
20091488 Relationship of fetuin-A with glomerular filtration rate and endothelial dysfunction in moderate-severe chronic kidney disease.
20031641 2009 Association of AHSG gene polymorphisms with fetuin-A plasma levels and cardiovascular diseases in the EPIC-Potsdam study.
20019453 2009 The relationship between coronary calcification and the metabolic markers of osteopontin, fetuin-A, and visfatin.
20015522 2010 Fetuin-A and atherosclerotic calcified plaque in patients with type 2 diabetes mellitus.
19931899 2010 Fetuin-A gene polymorphism in patients with calcium oxalate stone disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910501 2010 Association of lower plasma fetuin-a levels with peripheral arterial disease in type 2 diabetes.
19896717 2010 Dissecting cross-reactivity in hymenoptera venom allergy by circumvention of alpha-1,3-core fucosylation.
19862540 2010 Is increased maternal endothelin-1 concentration associated with neonatal asphyxia and preterm delivery in intrahepatic cholestasis of pregnancy?
19857676 2009 Recipient genetic determinants of inflammatory process and nonstandard atherosclerosis risk factors affect kidney graft function early posttransplantation.
19857655 2009 Impact of donor-dependent genetic factors on long-term renal graft function.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19681840 2009 Association among serum fetuin-A level, coronary artery calcification, and bone mineral densitometry in maintenance hemodialysis patients.
19672022 2009 High glucose induces transactivation of the alpha2-HS glycoprotein gene through the ERK1/2 signaling pathway.
19615685 2009 High plasma fetuin-A is associated with increased carotid intima-media thickness in a middle-aged population.
19602903 2009 Increased aortic wall stiffness associated with low circulating fetuin A and high C-reactive protein in predialysis patients.
19478814 2009 Preeclampsia is associated with decreased serum alpha(2)-HS glycoprotein (fetuin-A) concentration.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19358088 2009 AHSG gene variation is not associated with regional body fat distribution--a magnetic resonance study.
19194829 2009 Role of immunogenic fetuin A on L5178Y-R lymphoma tumorigenesis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19151998 2009 Immunohistochemical localization and mRNA expression of matrix Gla protein and fetuin-A in bone biopsies of hemodialysis patients.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19110009 2009 Fetuin-A and arterial stiffness in patients with normal kidney function.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19031279 2008 Serum fetuin-A/alpha2-HS-glycoprotein in human pregnancies with normal and restricted fetal growth.
19029462 2008 Plasma fetuin-a levels and the risk of myocardial infarction and ischemic stroke.
19016589 2009 Fetuin-A and BMD in older persons: the Health Aging and Body Composition (Health ABC) study.
18728159 2008 Fetuin-A and its relation to metabolic syndrome and fatty liver disease in obese children before and after weight loss.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18633113 2008 Plasma fetuin-A levels and the risk of type 2 diabetes.
18612115 2008 Fetuin-A and incident diabetes mellitus in older persons.
18364352 2008 Hierarchical role of fetuin-A and acidic serum proteins in the formation and stabilization of calcium phosphate particles.
18337634 2008 Is fetuin-A/alpha2-Heremans-Schmid glycoprotein associated with the metabolic syndrome in patients with chronic kidney disease?
18335040 2008 Fetuin-A induces cytokine expression and suppresses adiponectin production.
18334823 2008 Serum fetuin-a concentration and endothelial dysfunction in chronic kidney disease.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18316360 2008 AHSG tag single nucleotide polymorphisms associate with type 2 diabetes and dyslipidemia: studies of metabolic traits in 7,683 white Danish subjects.
18286307 2008 Circulating calcification inhibitors and vascular properties in children after renal transplantation.
18281421 2008 Serum alpha 2-HS glycoprotein predicts survival in patients with glioblastoma.
18089450 2008 Relationship between fetuin-A concentration, elevated levels of inflammatory markers, and arterial wall stiffness in end-stage kidney disease.
18088087 2008 Phosphoproteome of resting human platelets.
18085392 2007 Evaluation of serum fetuin-A relationships with biochemical parameters in patients on hemodialysis.
18065755 2008 Marked defects in the expression and glycosylation of alpha2-HS glycoprotein/fetuin-A in plasma from neonates with intrauterine growth restriction: proteomics screening and potential clinical implications.
17960182 2008 Fetuin-A: a major fetal serum protein that promotes "wound closure" and scarless healing.
17889958 2008 A promoter polymorphism of the alpha2-HS glycoprotein gene is associated with its transcriptional activity.
17882149 2007 Fetuin-A is not associated with mortality in chronic kidney disease.
17851232 2007 Gene polymorphisms and serum alpha-2-Heremans-Schmid levels in Italian haemodialysis patients.
17702860 2007 Fetuin-A is an independent predictor of death after ST-elevation myocardial infarction.
17611637 2007 Systemic and local levels of fetuin-A in calcific aortic valve stenosis.
17557141 2007 AHSG gene polymorphisms are associated with bone mineral density in Caucasian nuclear families.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17318070 2007 Endothelial dysfunction and fetuin A levels before and after kidney transplantation.
17303000 2007 Association and linkage analysis of COL1A1 and AHSG gene polymorphisms with femoral neck bone geometric parameters in both Caucasian and Chinese nuclear families.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17062776 2007 Association of alpha2-Heremans-Schmid glycoprotein polymorphisms with subclinical atherosclerosis.
17010978 2007 Association of high alpha2-Heremans-Schmid glycoprotein/fetuin concentration in serum and intima-media thickness in patients with atherosclerotic vascular disease and low bone mass.
16968979 2006 Serum fetuin-A levels link inflammation and cardiovascular calcification in hemodialysis patients.
16898488 2006 [Fetuin A in children with renal diseases].
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16567568 2006 Association between human fetuin-A and the metabolic syndrome: data from the Heart and Soul Study.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16318278 2005 Alpha2-HS glycoprotein gene is associated with bone size at the hip in Chinese.
16117875 2005 Contribution of genotype and ethnicity to bone mineral density variation in Caucasians and Chinese: a test for five candidate genes for bone mass.
16113307 2005 Fetuin-A, a hepatocyte-specific protein that binds Plasmodium berghei thrombospondin-related adhesive protein: a potential role in infectivity.
16046317 2005 A synonymous coding polymorphism in the alpha2-Heremans-schmid glycoprotein gene is associated with type 2 diabetes in French Caucasians.
16024912 2005 Polymorphism of the AHSG gene is associated with increased adipocyte beta2-adrenoceptor function.
16002217 2005 Genetic association of alpha2-Heremans-Schmid glycoprotein polymorphism with late-onset Alzheimer's disease in Italians.
15931001 2005 Fetuin-A and extraosseous calcification in uremia.
15917161 2005 Bone mineral density and five prominent candidate genes in Chinese men: associations, interaction effects and their implications.
15882283 2005 Low fetuin-A levels are associated with cardiovascular death: Impact of variations in the gene encoding fetuin.
15806395 2005 AHSG gene variant is associated with leanness among Swedish men.
15599699 2004 alpha2-Heremans-Schmid glycoprotein gene polymorphisms are associated with adipocyte insulin action.
15592877 2005 Association of alpha2-HS glycoprotein (AHSG, fetuin-A) polymorphism with AHSG and phosphate serum levels.
15589849 2004 Association between human alpha 2-Heremans Schmidt glycoprotein (AHSG) polymorphism and endometriosis in Korean women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667137 2003 No evidence for linkage and/or association of human alpha2-HS glycoprotein gene with bone mineral density variation in Chinese nuclear families.
12914574 2003 Differentiation of Caucasians and Chinese at bone mass candidate genes: implication for ethnic difference of bone mass.
12773197 2003 A physiological role for alpha2-HS glycoprotein: stimulation of macrophage uptake of apoptotic cells.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12725640 2003 Fetuin/alpha2-HS glycoprotein enhances phagocytosis of apoptotic cells and macropinocytosis by human macrophages.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12642050 2003 Association of low fetuin-A (AHSG) concentrations in serum with cardiovascular mortality in patients on dialysis: a cross-sectional study.
12556469 2003 Structural basis of calcification inhibition by alpha 2-HS glycoprotein/fetuin-A. Formation of colloidal calciprotein particles.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207096 2002 Novel insights into uremic vascular calcification: role of matrix Gla protein and alpha-2-Heremans Schmid glycoprotein/fetuin.
12203945 alpha2-Heremans Schmid glycoprotein, a putative inhibitor of tyrosine kinase, prevents glucose toxicity associated with cardiomyocyte dysfunction.
12153747 2002 Correlation of maternal serum fetuin/alpha2-HS-glycoprotein concentration with maternal insulin resistance and anthropometric parameters of neonates in normal pregnancy and gestational diabetes.
12140560 2002 E3 ubiquitin ligase that recognizes sugar chains.
12071714 2002 The interaction of recombinant decorin with alpha2HS-glycoprotein-implications for structural and functional investigations.
11788587 2002 Involvement of phosphatidylinositol 3-kinase, but not RalGDS, in TC21/R-Ras2-mediated transformation.
11439093 2001 Phosphorylation of human plasma alpha2-Heremans-Schmid glycoprotein (human fetuin) in vivo.
11415520 2001 Haplotype analysis of the human alpha2-HS glycoprotein (fetuin) gene.
10947975 2000 Fetuin-B, a second member of the fetuin family in mammals.
10550518 1999 Localization and inhibitory activity of alpha(2)HS-glycoprotein in the kidney.
9322749 1997 Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG).
9003486 1997 Molecular evidence for human alpha 2-HS glycoprotein (AHSG) polymorphism.
8940198 1996 Limited proteolysis of human alpha2-HS glycoprotein/fetuin. Evidence that a chymotryptic activity can release the connecting peptide.
7906861 1993 Serum alpha 2-HS-glycoprotein is an inhibitor of the human insulin receptor at the tyrosine kinase level.
7736783 1995 Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27.
6833285 1983 Characterization of the B-chain of human plasma alpha 2HS-glycoprotein. The complete amino acid sequence and primary structure of its heteroglycan.
6803836 1982 Purification and physicochemical characterization of human alpha 2-HS-glycoprotein.
3944104 1986 The complete amino acid sequence of the A-chain of human plasma alpha 2HS-glycoprotein.
3924066 1985 Identification and quantitation of alpha 2-HS-glycoprotein in the mineralized matrix of calcified plaques of atherosclerotic human aorta.
3474608 1987 Human alpha 2-HS-glycoprotein: the A and B chains with a connecting sequence are encoded by a single mRNA transcript.
3356172 1988 Human alpha 2-HS-glycoprotein localized to 3q27----q29 by in situ hybridization.
2760061 1989 The arrangement of disulfide loops in human alpha 2-HS glycoprotein. Similarity to the disulfide bridge structures of cystatins and kininogens.
2645941 1989 The position of the disulfide bonds in human plasma alpha 2 HS-glycoprotein and the repeating double disulfide bonds in the domain structure.
2054237 1991 Alpha 2-HS-glycoprotein: expression in chondrocytes and augmentation of alkaline phosphatase and phospholipase A2 activity.