Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.84
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.300 8.9e-03
colon cancer -2.700 1.8e-02
group 3 medulloblastoma -1.200 1.3e-03
intraductal papillary-mucinous adenoma (... 1.300 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.0e-02
lung cancer -2.200 2.7e-03
lung carcinoma -1.100 8.9e-14
malignant mesothelioma -1.500 4.5e-07
medulloblastoma, large-cell -1.300 4.9e-03
non-small cell lung cancer -1.336 2.3e-12
ulcerative colitis -1.500 2.1e-06

Gene RIF (1)

AA Sequence

MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPA      1 - 70
AALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIG     71 - 140
RRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPA    141 - 210
LMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFA    211 - 280
WKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAG    281 - 350
KLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV    351 - 420
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASL    421 - 490
RTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQ    491 - 560
DVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY                       561 - 611
//

Text Mined References (16)

PMID Year Title