Property Summary

NCBI Gene PubMed Count 31
PubMed Score 43.23
PubTator Score 26.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.342 3.1e-04
group 4 medulloblastoma -2.000 1.7e-06
glioblastoma -1.200 1.5e-02
atypical teratoid / rhabdoid tumor -1.600 5.2e-06
medulloblastoma, large-cell -2.200 9.9e-05
primitive neuroectodermal tumor -1.400 1.4e-03
ulcerative colitis -1.201 2.8e-02
acute quadriplegic myopathy 1.240 2.5e-04
subependymal giant cell astrocytoma -1.215 1.4e-02
lung adenocarcinoma 1.170 3.4e-06
ovarian cancer 2.300 5.6e-07
Down syndrome 1.700 6.1e-04

Gene RIF (14)

PMID Text
26509711 IRBIT forms signaling complexes with PIPKIalpha and NBCe1-B, whose activity is regulated by PI(4,5)P2.
25237103 Formation of the Ribonucleotide reductase-IRBIT complex is regulated through phosphorylation of IRBIT, and ablation of IRBIT expression in HeLa cells causes imbalanced dNTP pools and altered cell cycle progression.
24518248 IRBIT is a master regulator of ion channels and ion transporters. (Review)
24489003 HIV-1 Tat modulates IRBIT expression in neuron cells
23769829 IRBIT plays an important role in intracellular pH regulation, mediated by NHE3, and further regulated by SPAK.
23431199 relationships between the WNK/SPAK and IRBIT/PP1 sites in the regulation of Na+-HCO3- cotransporters
22826361 conclude that AHCYL1 expression is associated with ovarian carcinogenesis as an oncogene in chickens, whereas it plays the role of tumor suppressor in human EOC, suggesting a paradoxical function of AHCYL1 in ovarian carcinogenesis
22012331 A NBCe1-B construct that lacks amino acid residues 2-16 of the amino-terminus is fully autoinhibited, but cannot be stimulated by IRBIT, indicating that autoinhibitory and IRBIT-binding determinants within the cytosolic amino-terminus are not identical.
21956116 HIV-1 Tat modulates IRBIT expression in neuron cells
21317537 IRBIT opposes the effects of WNKs and SPAK by recruiting PP1 to the complex to dephosphorylate CFTR and NBCe1-B, restoring their cell surface expression, in addition to stimulating their activities
21242704 Both IRBIT (inositol 1,4,5-trisphosphate receptor-binding protein) and WNK [with no lysine (K)] kinase have been implicated as additional HCO(3)(-) secretory controllers.
20584908 IRBIT is critically involved in mediating activation of NHE3 by ANG II via a Ca(2+)/calmodulin-dependent protein kinases II-dependent pathway.
19220705 An IRBIT homologue, Long-IRBIT, demonstrates only weak binding ability to inositol 1,4,5-trisphosphate receptor because of an inhibitory effect of its LISN domain, a Long-IRBIT specific N-terminal appendage.
16769890 regulation through IRBIT enables NBC1 variants to have different physiological roles

AA Sequence

MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS      1 - 70
STDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGE     71 - 140
KPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW    141 - 210
CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVND    211 - 280
SVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA    281 - 350
CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR    351 - 420
SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE    421 - 490
YVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY                                  491 - 530
//

Text Mined References (38)

PMID Year Title
26509711 2015 IRBIT Interacts with the Catalytic Core of Phosphatidylinositol Phosphate Kinase Type I? and II? through Conserved Catalytic Aspartate Residues.
25416956 2014 A proteome-scale map of the human interactome network.
25237103 2014 Enzyme regulation. IRBIT is a novel regulator of ribonucleotide reductase in higher eukaryotes.
24518248 2014 IRBIT: a regulator of ion channels and ion transporters.
23769829 2013 IRBIT plays an important role in NHE3-mediated pHi regulation in HSG cells.
23431199 2013 Convergence of IRBIT, phosphatidylinositol (4,5) bisphosphate, and WNK/SPAK kinases in regulation of the Na+-HCO3- cotransporters family.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22826361 2012 Paradoxical expression of AHCYL1 affecting ovarian carcinogenesis between chickens and women.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
22012331 2012 Relief of autoinhibition of the electrogenic Na-HCO(3) [corrected] cotransporter NBCe1-B: role of IRBIT vs.amino-terminal truncation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21317537 2011 IRBIT governs epithelial secretion in mice by antagonizing the WNK/SPAK kinase pathway.
21269460 2011 Initial characterization of the human central proteome.
21242704 2010 Primers on molecular pathways: bicarbonate transport by the pancreas.
20584908 2010 Activation of Na+/H+ exchanger NHE3 by angiotensin II is mediated by inositol 1,4,5-triphosphate (IP3) receptor-binding protein released with IP3 (IRBIT) and Ca2+/calmodulin-dependent protein kinase II.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19224921 2009 Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation.
19220705 2009 An IRBIT homologue lacks binding activity to inositol 1,4,5-trisphosphate receptor due to the unique N-terminal appendage.
18829453 2008 IRBIT, inositol 1,4,5-triphosphate (IP3) receptor-binding protein released with IP3, binds Na+/H+ exchanger NHE3 and activates NHE3 activity in response to calcium.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16793548 2006 IRBIT suppresses IP3 receptor activity by competing with IP3 for the common binding site on the IP3 receptor.
16769890 2006 IRBIT, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).
16754674 2006 Suppression and overexpression of adenosylhomocysteine hydrolase-like protein 1 (AHCYL1) influences zebrafish embryo development: a possible role for AHCYL1 in inositol phospholipid signaling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12525476 2003 IRBIT, a novel inositol 1,4,5-trisphosphate (IP3) receptor-binding protein, is released from the IP3 receptor upon IP3 binding to the receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11904675 2002 Identification of an S-adenosylhomocysteine hydrolase-like transcript induced during dendritic cell differentiation.
10070969 1999 Increased ultraviolet sensitivity and chromosomal instability related to P53 function in the xeroderma pigmentosum variant.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7782076 1995 Characterization of a large population of mRNAs from human testis.