Property Summary

Ligand Count 3
NCBI Gene PubMed Count 35
PubMed Score 46.17
PubTator Score 26.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.240 2.5e-04
atypical teratoid / rhabdoid tumor -1.600 5.2e-06
Down syndrome 1.700 6.1e-04
glioblastoma -1.200 1.5e-02
group 3 medulloblastoma -1.500 4.3e-05
lung adenocarcinoma 1.170 3.4e-06
medulloblastoma, large-cell -1.300 2.2e-03
osteosarcoma 1.342 3.1e-04
ovarian cancer -1.500 4.6e-06
primitive neuroectodermal tumor -1.400 1.4e-03
subependymal giant cell astrocytoma -1.182 1.5e-02
ulcerative colitis -1.201 2.8e-02

Gene RIF (16)

AA Sequence

MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS      1 - 70
STDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGE     71 - 140
KPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW    141 - 210
CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVND    211 - 280
SVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA    281 - 350
CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR    351 - 420
SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE    421 - 490
YVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY                                  491 - 530
//

Text Mined References (42)

PMID Year Title