Property Summary

NCBI Gene PubMed Count 59
PubMed Score 479.22
PubTator Score 235.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 1.7e-03

Protein-protein Interaction (4)

Gene RIF (36)

PMID Text
26687445 H19 knockdown activates SAHH, leading to increased DNMT3B-mediated methylation of an lncRNA-encoding gene Nctc1 within the Igf2-H19-Nctc1 locus.
26527160 SAH hydrolase deficiency can remain asymptomatic in childhood, and the disorder can be associated with early onset hepatocellular carcinoma.
25248746 S-adenosylhomocysteine hydrolase is regulated by lysine acetylation
24430301 SAHH can promote apoptosis, inhibit migration and adhesion of ESCC cells suggesting that it may be involved in carcinogenesis of the esophagus.
23079506 A fluorescence-based assay for the measurement of S-adenosylhomocysteine hydrolase activity in biological samples.
22190034 HIV-1 Tat is identified to have a physical interaction with adenosylhomocysteinase (AHCY; SAHH) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22023331 The simulations of ligand-induced transition revealed that the signal of intrasubunit closure dynamics is transmitted to form intersubunit contacts, which in turn invoke a precise alignment of active site.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20392501 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19683694 Observational study of gene-disease association. (HuGE Navigator)
19619139 S-adenosylhomocysteine hydrolase
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18769049 These data show that 2-5-fold enhanced AdoHcyase activity is well tolerated by the cell, while greatly enhanced AdoHcyase activity results in adenosine-induced apoptosis.
18713839 SAHH mRNA was lost in 50% of tumor tissues from 206 patients with different kinds of tumors in comparison with normal tissue counterparts. Moreover, SAHH protein was also affected in some colon cancers
18683034 increased plasma concentration in patients with idiopathic thrombocytopenic purpura
18635682 Observational study of gene-disease association. (HuGE Navigator)
18522500 Streptococcal pyrogenic exotoxin B (SPE B) potentially causes immunosuppression by cleaving human S-adenosylhomocysteine hydrolase (AdoHcyase).
18427977 Observational study of genetic testing. (HuGE Navigator)
18393535 SAHH from Homo sapiens (Hs-SAHH) and from the parasite Trypanosoma cruzi (Tc-SAHH) are very similar in structure and catalytic properties but differ in the kinetics and thermodynamics of association and dissociation of the cofactor NAD (+)
18211827 consider changes in charge and the sterical incompatibility in mutant p.A89V protein as main reason for enzyme malfunction with AdoHcyase deficiency as consequence
17892301 The mechanism of action of copper on this enzyme sugges a regulative role for copper on the intracellular activity.
17688412 We found clinically relevant levels of Hcy (0-500 microM) induced elevation of SAH, declination of SAM and SAM/SAH ratio and reduced expression of SAHH and MBD2, but increased activity of DNMT3a and DNMT3b affecting DNA methylation
17447732 In the case of Hs-SAHH, the slow-binding phase terminates in micromolar affinity, but over a period of hours, the dissociation rate constant decreases until the final equilibrium affinity is in the nanomolar range.
17172447 SAHH, which is diffuse in the cytoplasm of nonmotile Dictyostelium amoebae and human neutrophils, concentrates with F-actin in pseudopods at the front of motile, chemotaxing cells
17164794 R38W and G123R amino-acid exchanges did not bring about major changes to the catalytic rates. However, circular dichroism analysis showed that both polymorphisms effect the thermal stability.
17097637 AdoHcy is involved in adenosine-induced apoptosis by altering gene expression.
15241484 Observational study of gene-disease association. (HuGE Navigator)
12590576 Maintenance of ionizable active-site residues in catalytically suitable protonation states in closed forms of placental AHCY may be assisted by a water chain, stabilized by Asp182, that can import and export protons from and to the environment.
12369977 a discussion of its hydrolytic activity (review)
12069606 Five active site residues (E156, N181, K186, D190, N191) of AdoHcy hydrolase have been individually mutated to alanine and each engineered enzyme characterized with respect to its redox partial reaction and elimination/addition partial reaction.

AA Sequence

MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTL      1 - 70
GAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIH     71 - 140
TKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM    141 - 210
IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID    211 - 280
IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA    281 - 350
MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS    351 - 420
CDGPFKPDHYRY                                                              421 - 432
//

Text Mined References (65)

PMID Year Title
26687445 2015 H19 lncRNA alters DNA methylation genome wide by regulating S-adenosylhomocysteine hydrolase.
26527160 2015 Adult-onset liver disease and hepatocellular carcinoma in S-adenosylhomocysteine hydrolase deficiency.
25416956 2014 A proteome-scale map of the human interactome network.
25248746 2014 Regulation of S-adenosylhomocysteine hydrolase by lysine acetylation.
24430301 2014 Overexpression of S-adenosylhomocysteine hydrolase (SAHH) in esophageal squamous cell carcinoma (ESCC) cell lines: effects on apoptosis, migration and adhesion of cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23079506 2013 A fluorescence-based assay for the measurement of S-adenosylhomocysteine hydrolase activity in biological samples.
22023331 2011 Link between allosteric signal transduction and functional dynamics in a multisubunit enzyme: S-adenosylhomocysteine hydrolase.
21269460 2011 Initial characterization of the human central proteome.
20852937 2010 S-adenosylhomocysteine hydrolase deficiency: two siblings with fetal hydrops and fatal outcomes.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19683694 2009 Genetic association study of putative functional single nucleotide polymorphisms of genes in folate metabolism and spina bifida.
19619139 2009 Human S-adenosylhomocysteine hydrolase: common gene sequence variation and functional genomic characterization.
19177456 2009 S-adenosylhomocysteine hydrolase (AHCY) deficiency: two novel mutations with lethal outcome.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18769049 2008 S-Adenosylhomocysteine hydrolase overexpression in HEK-293 cells: effect on intracellular adenosine levels, cell viability, and DNA methylation.
18713839 2008 S-adenosylhomocysteine hydrolase downregulation contributes to tumorigenesis.
18683034 2008 Decreased DNA methyltransferase 3A and 3B mRNA expression in peripheral blood mononuclear cells and increased plasma SAH concentration in adult patients with idiopathic thrombocytopenic purpura.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18522500 2008 Streptococcal pyrogenic exotoxin B cleaves human S-adenosylhomocysteine hydrolase and induces hypermethioninemia.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18393535 2008 Comparative kinetics of cofactor association and dissociation for the human and trypanosomal S-adenosylhomocysteine hydrolases. 2. The role of helix 18 stability.
18211827 2008 S-Adenosylhomocysteine hydrolase (AdoHcyase) deficiency: enzymatic capabilities of human AdoHcyase are highly effected by changes to codon 89 and its surrounding residues.
17892301 2007 Copper ions inhibit S-adenosylhomocysteine hydrolase by causing dissociation of NAD+ cofactor.
17688412 2007 Homocysteine-mediated expression of SAHH, DNMTs, MBD2, and DNA hypomethylation potential pathogenic mechanism in VSMCs.
17447732 2007 Comparative kinetics of cofactor association and dissociation for the human and trypanosomal S-adenosylhomocysteine hydrolases. 1. Basic features of the association and dissociation processes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17172447 2006 S-adenosylhomocysteine hydrolase is localized at the front of chemotaxing cells, suggesting a role for transmethylation during migration.
17164794 2007 Functional analysis of human S-adenosylhomocysteine hydrolase isoforms SAHH-2 and SAHH-3.
17097637 2007 Role of S-adenosylhomocysteine hydrolase in adenosine-induced apoptosis in HepG2 cells.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16736098 2006 S-adenosylhomocysteine hydrolase deficiency in a 26-year-old man.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15241484 2004 Effect of genetic variation in the human S-adenosylhomocysteine hydrolase gene on total homocysteine concentrations and risk of recurrent venous thrombosis.
15024124 2004 S-adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12590576 2003 Catalytic strategy of S-adenosyl-L-homocysteine hydrolase: transition-state stabilization and the avoidance of abortive reactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369977 2001 Targeting "hydrolytic" activity of the S-adenosyl-L-homocysteine hydrolase.
12063172 2002 Interaction of S-adenosylhomocysteine hydrolase of Xenopus laevis with mRNA(guanine-7-)methyltransferase: implication on its nuclear compartmentalisation and on cap methylation of hnRNA.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10933798 2000 Substrate binding stabilizes S-adenosylhomocysteine hydrolase in a closed conformation.
9586999 1998 Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
7786017 1995 Limited proteolysis of S-adenosylhomocysteine hydrolase: implications for the three-dimensional structure.
7608178 1995 Photoaffinity labeling of human placental S-adenosylhomocysteine hydrolase with [2-3H]8-azido-adenosine.
7079734 1982 The human genes for S-adenosylhomocysteine hydrolase and adenosine deaminase are syntenic on chromosome 20.
6586634 1984 Regional localization of the human genes for S-adenosylhomocysteine hydrolase (cen----q131) and adenosine deaminase (q131----qter) on chromosome 20.
6580258 1983 Genetics of human S-adenosylhomocysteine hydrolase. A new polymorphism in man.
2596825 1989 Sequence of full length cDNA for human S-adenosylhomocysteine hydrolase.
2574561 1989 Isozyme and DNA analysis of human S-adenosyl-L-homocysteine hydrolase (AHCY).
715439 1978 S-adenosylhomocysteine hydrolase is an adenosine-binding protein: a target for adenosine toxicity.
309884 1979 Apparent suicide inactivation of human lymphoblast S-adenosylhomocysteine hydrolase by 2'-deoxyadenosine and adenine arabinoside. A basis for direct toxic effects of analogs of adenosine.