Property Summary

NCBI Gene PubMed Count 27
PubMed Score 35.95
PubTator Score 13.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma 2.500 2.6e-15
glioblastoma 2.000 2.8e-06
osteosarcoma -2.565 4.9e-08
atypical teratoid/rhabdoid tumor 2.000 1.9e-08
juvenile dermatomyositis 1.144 4.9e-08
tuberculosis 2.300 9.3e-10
pediatric high grade glioma 2.000 1.2e-08
pilocytic astrocytoma 1.600 2.3e-08
ulcerative colitis 1.400 1.3e-06

Gene RIF (13)

PMID Text
25562590 A role for AT1 receptor-associated proteins in blood pressure regulation
23902639 ATRAP, a directly interacting and functionally inhibiting molecule of AT1R, plays a protective role against the development of systemic insulin resistance via regulatory effects on adipose tissue function.
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21423001 the GG genotype of the AGTRAP rs11121816 T/G single nucleotide polymorphism was associated with increased mortality in two cohorts of patients who had septic shock.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20541774 CSF angiotensin II, ACE, and ACE2 levels are decreased in neuromyelitis optica/NMO spectrum disorder patients with anti-AQP4 antibody, reflecting severe destruction of perivascular astrocytes
20018811 Small interfering RNA significantly attenuates angiotensin II type 1 receptor-stimulated inositol phosphate formation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19805740 Endogenous increases in angiotensin II during dehydration contribute to dehydration-associated sympathoexcitation.
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
14985364 mRNA is detected in all human tissues; cellular hypertrophy in cultured rat vascular smooth muscle and renal proximal tubular cells.
14559250 isolation of a novel protein, ARAP1, which promotes recycling of angiotensin(1A) to the plasma membrane in HEK-293 cells
11733189 cloned a new human gene cDNA that codes for a homolog of the murine Agtrap protein

AA Sequence

MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIV      1 - 70
HISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAE     71 - 140
APADPFAVPEGRSQDARGY                                                       141 - 159
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562590 2015 A role for AT1 receptor-associated proteins in blood pressure regulation.
25416956 2014 A proteome-scale map of the human interactome network.
23902639 2013 Angiotensin receptor-binding protein ATRAP/Agtrap inhibits metabolic dysfunction with visceral obesity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423001 2011 Association of angiotensin II type 1 receptor-associated protein gene polymorphism with increased mortality in septic shock.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20541774 2010 CSF angiotensin II and angiotensin-converting enzyme levels in anti-aquaporin-4 autoimmunity.
20018811 2010 The small GTPase Ral couples the angiotensin II type 1 receptor to the activation of phospholipase C-delta 1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19805740 2009 Influence of endogenous angiotensin II on control of sympathetic nerve activity in human dehydration.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15757644 2005 The novel angiotensin II type 1 receptor (AT1R)-associated protein ATRAP downregulates AT1R and ameliorates cardiomyocyte hypertrophy.
15668245 2005 Identification of calcium-modulating cyclophilin ligand (CAML) as transducer of angiotensin II-mediated nuclear factor of activated T cells (NFAT) activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985364 2004 A novel angiotensin II type 1 receptor-associated protein induces cellular hypertrophy in rat vascular smooth muscle and renal proximal tubular cells.
14559250 2003 Type 1 angiotensin II receptor-associated protein ARAP1 binds and recycles the receptor to the plasma membrane.
12960423 2003 The angiotensin II type I receptor-associated protein, ATRAP, is a transmembrane protein and a modulator of angiotensin II signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11733189 2002 Identification and characterization of AGTRAP, a human homolog of murine Angiotensin II Receptor-Associated Protein (Agtrap).
11162453 2000 ATRAP, novel AT1 receptor associated protein, enhances internalization of AT1 receptor and inhibits vascular smooth muscle cell growth.
10358057 1999 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor.