Property Summary

NCBI Gene PubMed Count 198
PubMed Score 1893.80
PubTator Score 841.53

Knowledge Summary

Patent (3,405)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.074 8.1e-04
non-small cell lung cancer -2.563 8.7e-13
lung cancer -2.500 1.3e-03
lung adenocarcinoma -1.100 1.4e-03
lung carcinoma -2.000 8.0e-06

 GWAS Trait (1)

 HCA RNA Cell Line (3)

 CSPA Cell Line (2)

Protein-protein Interaction (293)

GNAT3   GRM8   CORT   F2RL2   P2RY10   CXCR6   CCL21   CXCL11   FFAR1   FFAR3   NPFF   GRM6   CCL25   CCL16   FFAR2   MLNR   ADCY6   GNRH2   GALR2   HCRT   HCRTR1   HCRTR2   CXCL13   ADCY3   ADCY9   GALR3   GABBR2   S1PR2   UTS2   ADCY5   NTSR2   GNA14   S1PR4   F2   AGT   C3   C5   KNG1   GNRH1   OXT   AVP   POMC   PENK   PDYN   GCG   PPY   NPY   GAST   PPBP   PF4   CXCL10   ANXA1   GNAI2   APP   EDN1   CCK   GRP   GNAI3   NMB   CXCL1   NPS   SAA1   ADORA3   PYY   CXCL8   MLN   CCL5   EDN3   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   TAC1   PMCH   TRH   EDN2   TACR2   S1PR1   FPR1   CNR1   C5AR1   TBXA2R   DRD4   GAL   EDNRB   CXCR1   CXCR2   FPR3   FPR2   EDNRA   TACR1   PTAFR   ACKR3   F2R   NPY1R   HTR2C   NMBR   TACR3   GNA11   BDKRB2   GRPR   AGTR1   OXTR   GNA15   SSTR1   SSTR2   GNRHR   NTSR1   NTS   SSTR4   CCKAR   CCKBR   CCR1   CCR7   CXCR5   SSTR3   CNR2   TRHR   PTGER1   SSTR5   HRH1   OPRM1   APLNR   DRD3   AVPR1A   ADCY8   OPRD1   OPRK1   OPRL1   CASR   P2RY2   GRM5   CCR2   CXCL5   PTGFR   PTGER3   LPAR6   CCR10   GPR4   XCR1   BDKRB1   GALR1   GCGR   P2RY1   AVPR1B   XCL1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   GNAQ   NPY4R   P2RY4   CCR3   CCR4   CCR5   CCR6   CCR8   CCR9   ADCY7   F2RL1   CCL23   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   QRFP   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GRM1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY6   P2RY14   LTB4R   KISS1   GPR68   NPY5R   C3AR1   NMS   GPRC6A   PIK3R6   NPSR1   UTS2B   TAS2R42   MT-RNR2   GPR65   NPW   PROKR2   ADCY4   NPB   PROKR1   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   GHSR   ARHGEF1   KISS1R   MCHR2   P2RY11   QRFPR   OXGR1   GNRHR2   F2RL3   S1PR3   GPER1   LPAR4   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   NPFFR1   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PROK2   LTB4R2   PLCB1   CCL28   HEBP1   CYSLTR2   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   XCL2   GABBR1   GHRL   LPAR3   TAC3   OPN4   UTS2R   APLN   GPR132   CYSLTR1   GPR55   CCL27   HRH3   INSL5   NPFFR2   PTGDR2  

Gene RIF (188)

PMID Text
26867007 AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells
26616438 Angiotensin II type 2 receptor is present in human semen and may be involved in the control of sperm motility and male fertility.
26225830 Ang-(1-7) downregulated AT1R mRNA, upregulated mRNA levels of Ang II type 2 receptor (AT2R) and Mas receptor (MasR) and p38-MAPK phosphorylation and suppressed H22 cell-endothelial cell communication
26163449 ATGR2 activation enhances ACE2 expression and activity and prevents TNF-alpha-stimulated ICAM-1 expression .
25816156 The A1166C polymorphism of AT1R, A1675G and C3123A polymorphisms of AT2R were analyzed. The A1675G polymorphism of AT2R might be associated with preeclampsia
25713419 Suggest a key regulatory role of ATI and ATII in promoting cellular proliferation in infantile hemangioma, and establish a role for ACE and ATIIR2 in the proliferation of this tumour.
25682288 AT1 receptor expression was associated to enhance angiogenesis and cellular proliferation rate, but no relationship with AT2 was found
25487516 Activation of intracellular angiotensin AT receptors induces rapid cell death in non-cycling uterine leiomyosarcoma cells.
25172908 Ten tagging single nucleotide polymorphisms on AGTR1/AGTR2 were genotyped for all subjects with primary aldosteronism and controls.
25138435 in colorectal cancer, AT2R expression showed an inverse correlation with tumor stage and liver metastasis
24995698 Our results support that the AGTR2 gene may contribute to the pathogenesis of UPJO and the genetic origin of CAKUT could vary according to phenotype expression
24917146 Ang II induces corneal myofibroblasts resistance to apoptosis via activating NF-kappaB signaling pathway, and thus should be further investigated as a possible target for therapy of corneal fibrosis.
24887114 The AGTR2 gene C allele is associated with an increased proportion of slow-twitch muscle fibres.
24796630 Type 2 angiotensin II receptor (ATR2) expression was 3.5-fold higher in bronchoalveolar cells 1-6 h after lung with cardiopulmonary bypass transplantation.
24674681 These data indicate that the role of AT2R in human diseased arteries is divergent although the AT2R-mediated vasorelaxation prevails.
24440243 G allele of AT2R - 1332 G:A polymorphism is associated with an increased risk of preeclampsia.
24391821 Loss of angiotensin II type 2 receptor is associated with hepatocellular carcinoma.
24385301 We concluded that ATR1 CC genotype and ATR2 G allele increased the susceptibility of Egyptian males to have coronary artery disease .
23406015 In light of knowledge that AT2 R expression is regulated by oestrogen and that the prevalence of hypertension and cardiovascular risk is greater in women after menopause, AT2 R agonist therapy may represent an approach to treat hypertension.
23255326 Angiotensin II type 2 receptor antagonists could be particularly useful in the treatment of chronic pain and hypersensitivity associated with abnormal nerve sprouting
23176211 this review summarized previous investigations concerning AGTR1 and AGTR2 polymorphisms; most SNPs were not associated with increase risk for hypertension but have an affect on cardiovascular and renal phenotypes, such as cerebral ischemia, ischemic heart disease, LVH, renal insufficiency
23122839 AGTR2 C4599A in mothers, fathers and babies was associated with preeclampsia and this association was only apparent in pregnancies in which the women had a BMI >/= 25 kg/m(2), suggesting a gene-environment interaction.
22987376 In the present study, we showed that the 3123 C/A polymorphism of AGT2R gene is not a significant factor for hypertension in a sample of Tunisian population
22869520 angiotensin II type 2 receptor (AT2R) gene adenine/cytosine (A/C)-3123 polymorphism may be a marker associated with HDL metabolism by hypertension
22710646 Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells.
22407459 Report the presence of angiotensin receptors in human substantia nigra.
22162314 angiotensin II receptor type 2 receptors are indispensable during islet -like cell clusters maturation in vivo.
21937042 Angiotensin II type 1 receptor, but no type 2 receptor, interferes with the insulin-induced nitric oxide production in endothelial cells.
21850060 The data suggested that diameter of the retinal arterioles might be associated with the angiotensin II Type 2 Receptor 1675G/A polymorphism.
21740964 The study reveals a previously unrecognized mechanism of angiotensin receptor cross-talk involving cross-inhibition of AT1receptor internalization through heteromerization with the AT2 receptor subtype.
21671168 The polymorphism at AT (2) R gene was associated with the risk for aldosterone-producing adenoma.
21436209 The association of the mutated genotypes Met235Thr-AGT, Thr174Met-AGT, I/D-ACE, A2350G-ACE, A1166C-AT2R1, C3123A-AT2R2, (83)A/G-REN with the risk and outcome of pre-eclampsia, was evaluated.
21163866 This study therefore confirms a hypertrophy-modulating effect for AT(2)R also in hypertrophic cardiomyopathy.
20844184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20837730 Specific expression patterns for AGTR1 and AGTR2 in distinct trophoblast populations at the maternal-fetal interface and suggests that Ang II plays a role in placental development and generation of extravillous trophoblasts.
20732682 A1166C genetic variation of the angiotensin II type I receptor gene may not have a major role in susceptibility to coronary heart disease [meta-analysis]
20714875 The expression of AT2R in aldosterone-producing adenoma of the adrenal gland was lower than that in normal adrenal gland tissues. AT2R expression was negatively related to plasma aldosterone concentration but positively related with plasma renin activity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606419 Data suggest that genetic polymorphisms in the renin-angiotensin system are associated with renal phenotypes in the general population, but that many associations differ across racial/ethnic groups.
20606419 Observational study of gene-disease association. (HuGE Navigator)
20592051 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20486282 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20467270 Observational study of gene-disease association. (HuGE Navigator)
20371166 The present findings suggest that the homozygous form of the ATR gene may make improving systolic blood pressure and some obesity-related metabolic parameters through a dietary intervention difficult among obese women.
20371166 Observational study of gene-disease association. (HuGE Navigator)
20304486 The highest levels of expression of AT2R were found in early and mid TOP placentae compared to term pregnancy.
20300066 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20181281 Angiotensin II type 2 receptor signaling significantly attenuates growth of murine pancreatic carcinoma grafts in syngeneic mice
20149750 ACE DD and AT2R GG genotypes are associated with chronic kidney disease and scarring in PUV
20149750 Observational study of gene-disease association. (HuGE Navigator)
19996275 Data indicate that overexpression of AT2R led to apoptosis via an extrinsic cell death signaling pathway that is dependent on activation of p38 mitogen-activated protein kinase, caspase-8, and caspase-3 and p53.
19959996 Genetic polymorphism A1675G on AT2R gene affects cardiovascular risk and the severity of atherosclerosis by modifying systemic inflammation, especially in hypertensive males.
19959996 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19959718 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861353 The possible roles of AT(2) receptor activation in the brain, focusing on ischaemic stroke, cognitive function and neurogenesis, and potential effects of specific AT(2) receptor agonists, is reviewed.
19861352 Novel data from human oesophagus and jejunum suggest that the AT(1) receptor mediates muscular contractions and that the AT(2) receptor regulates epithelial functions.
19861351 This review focuses primarily on the common polymorphism -1332G/A of angiotensin II type 2 (AT(2)) receptor but also briefly mentions 3123C/A (located in the 3'-UTR).
19861349 The role of the AT(2) receptor on cardiovascular structure and disease, and the signalling pathways induced by its activation, is discussed.
19861347 This review focuses on the role of the AT(2) receptor in the kidney.
19861345 The loss of AT(2) receptor signalling is associated with increased renal injury and mortality in chronic kidney disease.
19820429 The aim of this study was to test the hypothesis that ACE I/D and AT2R 1675G>A are more frequent in patients suffering from the most severe episodes of hypoglycaemia requiring medical emergency treatment.
19820429 Observational study of gene-disease association. (HuGE Navigator)
19781541 The expression of angiotensin II receptor type 2 mRNA in human congenital anomalies of the kidney and urinary tract (CAKUT) was established and was not affected by -1332A/G polymorphism in children with CAKUT.
19779016 Ang II receptors and ACE are expressed in the human esophageal epithelium. AT(2)-receptor stimulation increases epithelial ion transport, whereas the AT(1) receptor inhibits ion transport and increases epithelial resistance.
19759061 The constitutive and ligand-mediated activity as well as the signal transduction of the AT(2) receptor, focusing on adapter proteins which directly bind to this receptor, is discussed.
19716087 Variations in AGTR1 and AGTR2 are associated with sudden cardiac arrest risk in a population-based case-control study.
19716087 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19524223 Suggest that a correct balance between AT1 and AT2 receptors expression may participate in the regulation of proliferation and apoptosis in the human follicle.
19509012 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19404281 angiotensin II acting through its type 2 receptor may even have beneficial effects in chronic kidney disease
19397700 Ang II activation of Smad2 occurs via the AT1 receptor, but not the AT2 receptor
19357319 Angiotensin II receptor type 2 signaling can be manipulated by modifying its export trafficking along the secretory pathway.
19344625 one transcriptional start site was detected in the AT2R promoter; AT2R activation increases AT2R promoter activity, thereby creating a positive feedback mechanism.
19308748 There is an association between pre-eclampsia/eclampsia and the GG-genotype of angiotensin type-2 receptor in Afro-Caribbean women
19288324 Observational study of gene-disease association. (HuGE Navigator)
19274051 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19194560 Observational study of gene-disease association. (HuGE Navigator)
19155782 Observational study of gene-disease association. (HuGE Navigator)
19082699 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074441 Abeta induces the formation of cross-linked AT2 oligomers that contribute to the dysfunction of Galphaq/11 in an animal model of Alzheimer disease.
19074439 AT2 oligomers inducing Galphaq/11 arrest are causally involved in inducing symptoms of neurodegeneration
19023273 No association was found between the AGTR2 polymorphism and the development of the metabolic syndrome in subjects screened for stage 1 hypertension.
19023273 Observational study of gene-disease association. (HuGE Navigator)
18848837 analysis of determinants of angiotensin II type 1 receptor functional selectivity [review]
18660489 Observational study of gene-disease association. (HuGE Navigator)
18594540 Expression of AT1 and AT2 is associated with high grade of malignancy, increased cellular proliferation, and angiogenesis, and is thus related to poor prognosis.
18534055 Data show that after silencing HCMV UL83 gene, gene expression of human brain vascular smooth muscle cell AT2 receptor is up-regulated.
18488444 The combination of the genotypes of genes ACE and AT2R (ID+3123C) was met significantly more frequently in male patients with tuberculosis.
18488444 Observational study of gene-disease association. (HuGE Navigator)
18437528 The AT2R A/C3123 polymorphism could be a polymorphic marker related to glycemic control, as presented in HbA1c, among general Japanese women.
18437528 Observational study of gene-disease association. (HuGE Navigator)
18417209 AT2 receptor may play an important role in the regulation of Ang II induced contractility of placental vascular smooth muscle cells.
18404604 AT2-receptor is expressed in human atherosclerotic plaque. Furthermore, we detected no functionally important role of AT2-receptor expression and found no evidence that ARB treatment regulates AT2-receptor expression.
18344519 In the presence of TIMP-3 and AGTR2, vascular endothelial growth factor-induced human umbilical vein endothelial cell proliferation was additively inhibited.
18331441 TNF-alpha induces renal tubular cell damage and AT1/AT2 receptor blockers showed cytoprotective effects probably via at least partly different mechanisms.
18328310 Observational study of gene-disease association. (HuGE Navigator)
18296263 These data indicates that the expression of AT1 receptors is altered in adrenal cancer and in pheochromocytomas. The expression of AT2 receptors, in turn, may be connected with the process of tumoral neo-angiogenesis.
18254975 Observational study of gene-disease association. (HuGE Navigator)
18205097 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18188697 Data show that glial as well as neuronal AT2 receptors can mediate the brain's responses to angiotensins.
18059164 Study provides evidence of the expression of the local angiotensin II system in lymph node metastases, and that ACE-, AT1R- and AT2R-activity promotes tumor cell invasion.
18049304 Although AT2 receptor mRNA is present in human internal mammary arteries, AT2 receptor stimulation does not mediate vasodilation in these arteries.
17944121 Observational study of gene-disease association. (HuGE Navigator)
17944121 +1675 G/A angiotensin II type 2 receptor (AT2R) gene polymorphism cannot be considered as a marker of left ventricular hypertrophy in patients with aortic stenosis.
17707359 Observational study of gene-disease association. (HuGE Navigator)
17707359 Hemizygosity for the G allele was found to be susceptibility factor for hypertension in males
17653210 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17630322 ANGII signaling occurs primarily via AGTR1 in normal fibroblasts, while AGTR2-mediated effects are dominant on activated (myo)-fibroblasts, a receptor switch that may perturb epithelial-mesenchymal interaction, thereby further perpetuating fibrogenesis.
17620959 Observational study of gene-disease association. (HuGE Navigator)
17548686 Observational study of gene-disease association. (HuGE Navigator)
17522061 Observational study of gene-disease association. (HuGE Navigator)
17515833 Observational study of gene-disease association. (HuGE Navigator)
17515833 Data indicate that the angiotensin II type 2 receptor gene A-1332G transition is not associated with the development of human congenital uropathies.
17499413 Observational study of gene-disease association. (HuGE Navigator)
17433630 AT1 an AT2 receptors are developmentally regulated in fetal skin, suggesting theh possible diverse actions that angiotensin II might play in development and maturation of skin
17393691 Both AT1 and AT2 receptors were expressed in the fibroblasts of hypertrophic scars, and Ang II regulates DNA synthesis in hypertrophic scar fibroblasts through a negative cross-talk between AT1 and AT2 receptors.
17336987 Observational study of gene-disease association. (HuGE Navigator)
17270098 Observational study of gene-disease association. (HuGE Navigator)
17261659 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17160213 Observational study of gene-disease association. (HuGE Navigator)
17160213 Mutations were not detected in the AGTR1 and AGTR2 genes in patients with premature adrenarche; however, two polymorphisms were identified in the AGTR1 gene: the C573T (exon 5) and the A1166C (3' untranslated region).
16954165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16944335 Observational study of gene-disease association. (HuGE Navigator)
16944335 There was no significant difference in the distribution of A and G-genotypes in any of the patient groups compared to controls. An A-->1675G transition in the AT2R gene seems not to be involved in the pathogenesis of aortic coarctation.
16609364 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16598200 Observational study of gene-disease association. (HuGE Navigator)
16598200 The ATG2 gene may have a gender-specific efefct on kidney function and pulse pressure in type I diabetic patients.
16550310 Observational study of gene-disease association. (HuGE Navigator)
16522324 AT(1) receptor-mediated activation of PI 3-K/Akt cascades occurs at least partially via the transactivation of EGF receptor, which is under a negative control by AT(2) receptor in hypertrophic scar fibroblasts.
16395664 angiotensin II receptor haplotype transmission is distorted in fetal growth restriction
16289034 CNK1 binds through the sterile alpha motif (SAM) and the conserved region in CNK (CRIC) to the AT2 receptor. CNK1 may play a role in the AT2 receptor-mediated signaling pathways.
16283672 Sequence variations in AGTR2 are unlikely to be associated with X-linked mental retardation.
16133060 Observational study of gene-disease association. (HuGE Navigator)
16112405 Abundant expression of AT2 receptors in all human fibroblasts studied.
16109806 Taken together, these data indicate that individuals carrying the G allele may express higher levels of AT2 receptor protein.
16080803 The AGTR2 A1675G polymorphism might be involved in the development of essential hypertension in Chinese men.
16080803 Observational study of gene-disease association. (HuGE Navigator)
15914614 Observational study of gene-disease association. (HuGE Navigator)
15710780 The AT2 receptor regulates expression of genes relevant to cell migration, protein processing, intracellular signaling, and DNA repair in both ligand-dependent and ligand-independent manners.
15638358 Increased expression in kidney tubule cells after physical exercise.
15470205 Observational study of gene-disease association. (HuGE Navigator)
15470205 a major role of the AT2R gene in the development of congenital uropathies has been found, at least in Italian children.
15458433 an imbalance of AT1R and AT2R activity in mesangial cells following exposure to pIgA plays a significant pathogenetic role in the inflammatory injury in IgA nephropathy.
15385810 Observational study of gene-disease association. (HuGE Navigator)
15385810 Polymorphism is not associated with increased risk of developing chronic kidney allograft dysfunction.
15221785 Observational study of gene-disease association. (HuGE Navigator)
15123577 Observational study of gene-disease association. (HuGE Navigator)
15123577 Comparison between hypertensive subjects with & w/o left ventricular hypertrophy showed an excess of the G_/GG genotype in the group with LVH. The angiotensin type-2 receptor (-1332 G) allele was associated with LVH in hypertensive subjects.
15117835 AT2 receptor-mediated vasodilation in the human heart appears to be limited to coronary microarteries and is mediated by B2 receptors and NO. Most likely, AT2 receptors are located on endothelial cells, and their contribution increases with age.
15013333 Observational study of gene-disease association. (HuGE Navigator)
15013322 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15013293 Observational study of gene-disease association. (HuGE Navigator)
14987254 AT1 and AT2 receptors were found within the epidermis and in dermal vessel walls.
14764974 Observational study of gene-disease association. (HuGE Navigator)
14657020 AT(2) enhances expression of p85 alpha PI3K followed by enhanced p70(S6) kinase
14627490 Observational study of gene-disease association. (HuGE Navigator)
14598163 AGTR2 mutations in male patients is associated with mental retardation
12925562 Observational study of gene-disease association. (HuGE Navigator)
12925562 Polymorphisms of the angiotensin II receptor, type 2 gene is associated with increased risk of coronary heart disease in hypertension.
12924622 Observational study of gene-disease association. (HuGE Navigator)
12924622 This analysis showed that the C4599A polymorphism of the Angiotensin-II type 2 receptor gene was associated with hypertension in women (p=0.0058), but not in men.
12911547 Ang II decreases activity of 11beta-HSD2 by AT2 receptor- and MAPK-dependent mechanism. Decreased activity of 11beta-HSD2 increases intracellular availability of cortisol. May be relevant for pathogenesis of hypertension and preeclampsia.
12881481 Findings may explain the reported antiangiogenic properties of the AT2 receptor.
12800945 Observational study of gene-disease association. (HuGE Navigator)
12746399 Rare polymorphisms in boys with non-specific mental retardation
12660887 mRNA levels as well as the protein production of angiotensin II receptors of type 2 was monitored during differentiation of primary human preadipocytes in culture and in mature adipocytes.
12579398 Observational study of gene-disease association. (HuGE Navigator)
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12531525 Results support the hypothesis that the DRY motif plays a significant role in the binding affinity, structural stability and G-protein recruiting of the angiotensin II type 2 receptor.
12522467 Observational study of gene-disease association. (HuGE Navigator)
12453540 Observational study of gene-disease association. (HuGE Navigator)
12453540 There is a potential implication of the AT2G+1675A polymorhism in patient with Left ventricular hypertrophy and coronary ischemia.
12187255 Observational study of gene-disease association. (HuGE Navigator)
12133421 explore the relation among myocardial AT(1)-/AT(2)- receptor expression, myocardial remodeling and cardiac function in patients with congestive heart failure
12089445 AGTR2 mutations in X-linked mental retardation; findings indicate a role for AGTR2 in brain development and cognitive function
11880254 AT(2) receptor inhibits smooth muscle cell migration via fibronectin cell production and binding.
11819093 AT(2) receptor overexpression is associated with breast disease, further confirming the involvement of the components of the renin-angiotensin system in the aetiology of breast cancer.
11544438 Observational study of gene-disease association. (HuGE Navigator)
11446495 Observational study of gene-disease association. (HuGE Navigator)
11324803 Observational study of gene-disease association. (HuGE Navigator)
11200871 Observational study of gene-disease association. (HuGE Navigator)
11153734 Observational study of gene-disease association. (HuGE Navigator)
11081769 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11053482 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFC      1 - 70
CQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSV     71 - 140
DRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAG    141 - 210
IALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDA    211 - 280
LAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR    281 - 350
KSSSLREMETFVS                                                             351 - 363
//

Text Mined References (200)

PMID Year Title
26867007 2016 Angiotensin II Type 2 Receptor Decreases Transforming Growth Factor-? Type II Receptor Expression and Function in Human Renal Proximal Tubule Cells.
26616438 2016 Angiotensin II type 2 receptor is expressed in human sperm cells and is involved in sperm motility.
26225830 2015 Angiotensin-(1-7) Suppresses Hepatocellular Carcinoma Growth and Angiogenesis via Complex Interactions of Angiotensin II Type 1 Receptor, Angiotensin II Type 2 Receptor and Mas Receptor.
26163449 2015 Activation of angiotensin II type 2 receptor suppresses TNF-?-induced ICAM-1 via NF-?B: possible role of ACE2.
25816156 2015 The effects of gene polymorphisms in angiotensin II receptors on pregnancy-induced hypertension and preeclampsia: a systematic review and meta-analysis.
25713419 2015 Angiotensin II causes cellular proliferation in infantile haemangioma via angiotensin II receptor 2 activation.
25682288 2015 Association between AT1 and AT2 angiotensin II receptor expression with cell proliferation and angiogenesis in operable breast cancer.
25487516 2015 Activation of intracellular angiotensin AT? receptors induces rapid cell death in human uterine leiomyosarcoma cells.
25172908 2015 Association of polymorphisms in AGTR1 and AGTR2 genes with primary aldosteronism in the Chinese Han population.
25138435 2014 Role of two types of angiotensin II receptors in colorectal carcinoma progression.
24995698 2014 Association of angiotensin type 2 receptor gene polymorphisms with ureteropelvic junction obstruction in Brazilian patients.
24917146 2014 NF-?B mediates the survival of corneal myofibroblast induced by angiotensin II.
24887114 2014 AGTR2 gene polymorphism is associated with muscle fibre composition, athletic status and aerobic performance.
24796630 2014 Angiotensin receptors as sensitive markers of acute bronchiole injury after lung transplantation.
24674681 Vasoactive role for angiotensin II type 2 receptors in human radial artery.
24440243 2014 AT2R -1332 G:A polymorphism and its interaction with AT1R 1166 A:C, ACE I/D and MMP-9 -1562 C:T polymorphisms: risk factors for susceptibility to preeclampsia.
24391821 2013 Effects of angiotensin II type 2 receptor overexpression on the growth of hepatocellular carcinoma cells in vitro and in vivo.
24385301 2014 Association of angiotensin II type I and type II receptor genes polymorphisms with the presence of premature coronary disease and metabolic syndrome.
23871722 2013 XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23406015 2013 Unmasking the potential of the angiotensin AT2 receptor as a therapeutic target in hypertension in men and women: what we know and what we still need to find out.
23255326 2013 Angiotensin II type 2 receptor (AT2 R) localization and antagonist-mediated inhibition of capsaicin responses and neurite outgrowth in human and rat sensory neurons.
23176211 2013 Gene polymorphism of angiotensin II type 1 and type 2 receptors.
23122839 2013 The association of AGTR2 polymorphisms with preeclampsia and uterine artery bilateral notching is modulated by maternal BMI.
22987376 Lack of association between C3123A polymorphism of the angiotensin II type 2 receptor gene and hypertension in Tunisian population.
22869520 2013 Association between angiotensin II Type 2 receptor gene A/C3123 polymorphism and high-density lipoprotein cholesterol with hypertension in asymptomatic women.
22710646 2012 Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells.
22407459 2013 Expression of angiotensinogen and receptors for angiotensin and prorenin in the monkey and human substantia nigra: an intracellular renin-angiotensin system in the nigra.
22162314 2012 Angiotensin II type 2 receptor is critical for the development of human fetal pancreatic progenitor cells into islet-like cell clusters and their potential for transplantation.
21937042 2011 Angiotensin II type 1 receptor, but no type 2 receptor, interferes with the insulin-induced nitric oxide production in HUVECs.
21850060 2011 Are retinal microvascular phenotypes associated with the 1675G/A polymorphism in the angiotensin II type-2 receptor gene?
21740964 2011 Heteromerization of angiotensin receptors changes trafficking and arrestin recruitment profiles.
21671168 2011 Association of polymorphisms in angiotensin II receptor genes with aldosterone-producing adenoma.
21602797 2011 Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2.
21436209 2011 Maternal/newborn genotype contribution of the renin-angiotensin system (Met235Thr, Thr174Met, I/D-ACE, A2350G-ACE, A1166C-AT2R1, C3123A- AT2R2, 83A/G-REN) to the risk of pre-eclampsia: a Romanian study.
21163866 2011 Genetic variation in angiotensin II type 2 receptor gene influences extent of left ventricular hypertrophy in hypertrophic cardiomyopathy independent of blood pressure.
20844184 2010 The angiotensin II receptor type 2 polymorphism influences haemodynamic function and circulating RAS mediators in normotensive humans.
20837730 2010 Differential expression of angiotensin II type 1 and type 2 receptors at the maternal-fetal interface: potential roles in early placental development.
20732682 2010 A1166C genetic variation of the angiotensin II type I receptor gene and susceptibility to coronary heart disease: collaborative of 53 studies with 20,435 cases and 23,674 controls.
20714875 2010 Expression of angiotensin II receptors in aldosterone-producing adenoma of the adrenal gland and their clinical significance.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606419 2010 Associations between genetic variants in the ACE, AGT, AGTR1 and AGTR2 genes and renal function in the Multi-ethnic Study of Atherosclerosis.
20592051 2010 Interactions among related genes of renin-angiotensin system associated with type 2 diabetes.
20486282 2010 Genetic variants in the renin-angiotensin-aldosterone system and salt sensitivity of blood pressure.
20467270 2010 Role of the angiotensin II type 2 receptor gene (+1675G/A) polymorphism on left ventricular hypertrophy and geometry in treated hypertensive patients.
20371166 2011 Genetic polymorphisms of the renin-angiotensin system and obesity-related metabolic changes in response to low-energy diets in obese women.
20304486 2010 Expression of AT1R, AT2R and AT4R and their roles in extravillous trophoblast invasion in the human.
20300066 2010 Genetic influence on baroreflex sensitivity in normotensive young men.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20181281 2010 Angiotensin II type 2 receptor signaling significantly attenuates growth of murine pancreatic carcinoma grafts in syngeneic mice.
20149750 2010 Association of angiotensin converting enzyme and angiotensin type 2 receptor gene polymorphisms with renal damage in posterior urethral valves.
19996275 2009 Angiotensin type 2 receptor-mediated apoptosis of human prostate cancer cells.
19959996 2010 Genetic polymorphism on type 2 receptor of angiotensin II, modifies cardiovascular risk and systemic inflammation in hypertensive males.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861353 2010 The angiotensin II type 2 receptor in the brain.
19861352 2010 The angiotensin II type 2 receptor and the gastrointestinal tract.
19861351 2010 Angiotensin II type 2 receptor gene polymorphisms in cardiovascular disease.
19861349 2010 The angiotensin II type 2 receptor in cardiovascular disease.
19861347 2010 The angiotensin II type 2 receptor and the kidney.
19861345 2010 The angiotensin II type 2 receptor in renal disease.
19820429 2009 Angiotensin-converting enzyme and angiotensin II receptor subtype 2 genotypes in type 1 diabetes and severe hypoglycaemia requiring emergency treatment: a case cohort study.
19781541 2010 Expression profiling of the AT2R mRNA in affected tissue from children with CAKUT.
19779016 2009 Angiotensin II receptors are expressed and functional in human esophageal mucosa.
19759061 2010 Adapter proteins and promoter regulation of the angiotensin AT2 receptor--implications for cardiac pathophysiology.
19716087 2009 Genetic variation in angiotensin-converting enzyme-related pathways associated with sudden cardiac arrest risk.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19524223 2010 Expression of angiotensin II type 1 (AT1) and angiotensin II type 2 (AT2) receptors in human granulosa-lutein (GL) cells: correlation with infertility diagnoses.
19509012 2009 Genetic variant of the Renin-Angiotensin system and diabetes influences blood pressure response to Angiotensin receptor blockers.
19404281 2009 Angiotensin II type 2 receptor in chronic kidney disease: the good side of angiotensin II?
19397700 2009 Angiotensin II activates connective tissue growth factor and induces extracellular matrix changes involving Smad/activation and p38 mitogen-activated protein kinase signalling pathways in human dermal fibroblasts.
19357319 2009 Rab1 GTPase and dimerization in the cell surface expression of angiotensin II type 2 receptor.
19344625 2009 Poly(ADP-ribose) polymerase-1 (PARP-1) transcriptionally regulates angiotensin AT2 receptor (AT2R) and AT2R binding protein (ATBP) genes.
19308748 2009 Angiotensin II type 1 and 2 receptors gene polymorphisms in pre-eclampsia and normal pregnancy in three different populations.
19288324 2009 Renin-angiotensin system polymorphisms: a risk factor for progression to end-stage renal disease in vesicoureteral reflux patients.
19274051 2010 Angiotensin receptor gene polymorphisms and 2-year change in hyperintense lesion volume in men.
19194560 2009 Association of angiotensin II type 2 receptor gene A1818T polymorphism with progression of immunoglobulin A nephropathy in Korean patients.
19155782 2009 The environmental and genetic evidence for the association of hyperlipidemia and hypertension.
19082699 2009 The rationale and design of the PERindopril GENEtic association study (PERGENE): a pharmacogenetic analysis of angiotensin-converting enzyme inhibitor therapy in patients with stable coronary artery disease.
19074441 2009 Angiotensin II AT2 receptor oligomers mediate G-protein dysfunction in an animal model of Alzheimer disease.
19074439 2009 Dominant negative AT2 receptor oligomers induce G-protein arrest and symptoms of neurodegeneration.
19023273 2009 Angiotensin II type 1 receptor gene polymorphism predicts development of hypertension and metabolic syndrome.
18848837 2009 Molecular determinants of angiotensin II type 1 receptor functional selectivity.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18594540 2008 Expression of AT1 and AT2 angiotensin receptors in astrocytomas is associated with poor prognosis.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18534055 2008 The expression of human brain vascular smooth muscle cell AT receptor after the UL83 gene of HCMV inhibition by small interfering RNAs.
18488444 2008 [Polymorphism of genes of the renin-angiotensin system ACE, AT1R, and AT2R in patients with pulmonary tuberculosis].
18437528 2009 An association between angiotensin II type 2 receptor gene A/C3123 polymorphism and glycemic control marker in a general Japanese population.
18417209 2008 Contractility of placental vascular smooth muscle cells in response to stimuli produced by the placenta: roles of ACE vs. non-ACE and AT1 vs. AT2 in placental vessel cells.
18404604 2008 Angiotensin type 2 receptor is expressed in human atherosclerotic lesions.
18344519 2008 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis.
18331441 2008 Angiotensin II receptor blocker inhibits tumour necrosis factor-alpha-induced cell damage in human renal proximal tubular epithelial cells.
18328310 2008 Genetic variation and activity of the renin-angiotensin system and severe hypoglycemia in type 1 diabetes.
18296263 2008 Immunohistochemical detection of angiotensin receptors AT1 and AT2 in adrenal tumors.
18254975 2008 Physiogenomic comparison of human fat loss in response to diets restrictive of carbohydrate or fat.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18205097 2007 Impact of renin-angiotensin-aldosterone system genes on the treatment response of patients with hypertension and metabolic syndrome.
18188697 2008 The significance of brain aminopeptidases in the regulation of the actions of angiotensin peptides in the brain.
18059164 2007 Expression of the local angiotensin II system in gastric cancer may facilitate lymphatic invasion and nodal spread.
18049304 2007 Angiotensin II type 2 receptor vasoactivity in internal mammary arteries of patients with coronary artery disease.
17944121 2007 Can angiotensin II +1675 G/A type 2 receptor gene polymorphism be a marker of left ventricular hypertrophy in patients with aortic stenosis?
17707359 X-linked angiotensin II type 2 receptor gene polymorphism -1332A/G in male patients with essential hypertension.
17653210 2007 Genetic variations associated with diabetic nephropathy and type II diabetes in a Japanese population.
17630322 2007 The angiotensin II receptor 2 is expressed and mediates angiotensin II signaling in lung fibrosis.
17620959 2007 High sodium intake modulates left ventricular mass in patients with G expression of +1675 G/A angiotensin II receptor type 2 gene.
17548686 2007 The angiotensin II/angiotensin II receptor system correlates with nodal spread in intestinal type gastric cancer.
17522061 2007 Renin-angiotensin system haplotypes and the risk of myocardial infarction and stroke in pharmacologically treated hypertensive patients.
17515833 2007 Angiotensin II type 2 receptor gene polymorphism in Caucasian children with a wide spectrum of congenital anomalies of the kidney and urinary tract.
17499413 2007 Renin-angiotensin-system gene polymorphisms and depression.
17433630 2007 Characterization of AT1 and AT2 receptor expression profiles in human skin during fetal life.
17393691 2007 [Role of angiotensin II receptors in proliferation of fibroblast derived from human hypertrophic scars].
17336987 2007 Effect of a common X-linked angiotensin II type 2-receptor gene polymorphism (-1332 G/A) on the occurrence of premature myocardial infarction and stenotic atherosclerosis requiring revascularization.
17270098 2007 The angiotensin II type 2 receptor gene polymorphism and body mass index in healthy Japanese women.
17261659 2007 Association between angiotensinogen, angiotensin II receptor genes, and blood pressure response to an angiotensin-converting enzyme inhibitor.
17160213 2006 [Mutation screening in Angiotensin II receptors, AGTR1 and AGTR2, and evaluation of AGTR1 polymorphisms C573T and A1166C in patients with premature adrenarche].
17159080 2007 Cross-talk between angiotensin II receptor types 1 and 2: potential role in vascular remodeling in humans.
17159079 2007 Angiotensin type 2 receptor in resistance arteries of type 2 diabetic hypertensive patients.
17000928 2006 Angiotensin II stimulates endothelial NO synthase phosphorylation in thoracic aorta of mice with abdominal aortic banding via type 2 receptor.
16954165 2006 Genetic variation in the renin-angiotensin system and autonomic nervous system function in young healthy Japanese subjects.
16944335 No evidence for angiotensin type 2 receptor gene polymorphism in intron 1 in patients with coarctation of the aorta and Ullrich-Turner syndrome.
16609364 2006 Restenosis after percutaneous coronary intervention is associated with the angiotensin-II type-1 receptor 1166A/C polymorphism but not with polymorphisms of angiotensin-converting enzyme, angiotensin-II receptor, angiotensinogen or heme oxygenase-1.
16598200 2006 The AT2 gene may have a gender-specific effect on kidney function and pulse pressure in type I diabetic patients.
16550310 2006 Angiotensin II type 2 receptor gene polymorphisms and cardioprotective role in essential hypertension.
16522324 2006 Angiotensin II regulates phosphoinositide 3 kinase/Akt cascade via a negative crosstalk between AT1 and AT2 receptors in skin fibroblasts of human hypertrophic scars.
16395664 2006 Altered transmission of maternal angiotensin II receptor haplotypes in fetal growth restriction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289034 2005 The scaffold protein CNK1 interacts with the angiotensin II type 2 receptor.
16283672 2005 Sequence variations in AGTR2 are unlikely to be associated with X-linked mental retardation.
16133060 2005 Implication of genetic variations in congenital obstructive nephropathy.
16112405 2005 Coexpression of AT1 and AT2 receptors by human fibroblasts is associated with resistance to angiotensin II.
16109806 2005 Intronic ANG II type 2 receptor gene polymorphism 1675 G/A modulates receptor protein expression but not mRNA splicing.
16080803 2005 [Relation between the angiotensin II type 2 receptor polymorphism and essential hypertension in men].
15914614 2005 Genetic polymorphisms in the angiotensin II receptor gene and their association with open-angle glaucoma in a Japanese population.
15772651 2005 The DNA sequence of the human X chromosome.
15710780 2005 Angiotensin II type 2 receptor-mediated gene expression profiling in human coronary artery endothelial cells.
15638358 2004 The role of AT1 and AT2 angiotensin receptors in the mechanism of apoptosis in renal tubular cells after physical exercise.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470205 2004 Angiotensin-converting enzyme and angiotensin type 2 receptor gene genotype distributions in Italian children with congenital uropathies.
15458433 2004 Mesangial expression of angiotensin II receptor in IgA nephropathy and its regulation by polymeric IgA1.
15385810 2004 Association of the genetic polymorphisms of the renin-angiotensin system and endothelial nitric oxide synthase with chronic renal transplant dysfunction.
15221785 2004 Haplotypes of the angiotensin II receptor genes AGTR1 and AGTR2 in women with normotensive pregnancy and women with preeclampsia.
15123706 2004 Trans-inactivation of receptor tyrosine kinases by novel angiotensin II AT2 receptor-interacting protein, ATIP.
15123577 2004 Left ventricle mass index and the common, functional, X-linked angiotensin II type-2 receptor gene polymorphism (-1332 G/A) in patients with systemic hypertension.
15117835 2004 Angiotensin II type 2 receptor-mediated vasodilation in human coronary microarteries.
15013333 Angiotensin-converting enzyme gene polymorphism significantly affects renal posttransplantation erythrocytosis.
15013322 The renin-angiotensin system and endothelial nitric oxide synthase gene polymorphisms and cyclosporine toxicity in renal transplant patients.
15013293 Angiotensin-converting enzyme genotype is a predictive factor in the peak panel-reactive antibody response.
14987254 2004 Human skin: source of and target organ for angiotensin II.
14764974 Genetic polymorphism of the renin-angiotensin system on the development of primary vesicoureteral reflux.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657020 2003 A novel angiotensin II type 2 receptor signaling pathway: possible role in cardiac hypertrophy.
14627490 2003 Angiotensin II type 2 receptor gene polymorphisms and essential hypertension.
14598163 2004 Identification of two AGTR2 mutations in male patients with non-syndromic mental retardation.
12925562 2003 Genetic variants of angiotensin II receptors and cardiovascular risk in hypertension.
12924622 2003 Association of angiotensin II type 2 receptor gene variant with hypertension.
12911547 2003 Angiotensin II regulates 11beta-hydroxysteroid dehydrogenase type 2 via AT2 receptors.
12881481 2003 Angiotensin II type 2 receptor inhibits vascular endothelial growth factor-induced migration and in vitro tube formation of human endothelial cells.
12800945 2003 Epidemiology of essential hypertension: the role of genetic polymorphism.
12746399 2003 Rare polymorphic variants of the AGTR2 gene in boys with non-specific mental retardation.
12660887 Expression of angiotensin II receptors type 1 and type 2 in human preadipose cells during differentiation.
12579398 2003 Renin-angiotensin system polymorphisms and renal scarring.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12531525 2002 Effects of mutations in the highly conserved DRY motif on binding affinity, expression, and G-protein recruitment of the human angiotensin II type-2 receptor.
12522467 2002 Association of polymorphisms of the renin-angiotensin system and bradykinin B2 receptor with ACE-inhibitor-related cough.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464615 2003 Cyclic AMP-independent involvement of Rap1/B-Raf in the angiotensin II AT2 receptor signaling pathway in NG108-15 cells.
12453540 2002 Angiotensin II type 2 receptor gene polymorphism and cardiovascular phenotypes: the GLAECO and GLAOLD studies.
12187255 2002 Angiotensin II type 2 receptor gene is not responsible for familial vesicoureteral reflux.
12133421 2002 [Gene expression of Ang II receptors in myocardium in congestive heart failure].
12089445 2002 AGTR2 mutations in X-linked mental retardation.
11709400 2001 Angiotensin receptors: signaling, vascular pathophysiology, and interactions with ceramide.
11544438 2001 Angiotensin gene polymorphism as a determinant of posttransplantation renal dysfunction and hypertension.
11459796 2001 Characterization of signal transduction pathway in neurotropic action of angiotensin II in brain neurons.
11446495 2001 The genetic factor in acute myocardial infarction with hypertension.
11324803 2001 Genetic background in patients with acute myocardial infarction.
11200871 2001 Albuminuria and the renin-angiotensin system gene polymorphisms in type-2-diabetic and in normoglycemic hypertensive Chinese.
11153734 2001 Effect of the angiotensin II type 2-receptor gene (+1675 G/A) on left ventricular structure in humans.
11081769 2000 Lack of association between polymorphisms of angiotensin II receptor genes and response to short-term angiotensin II infusion.
11055978 2000 Functional reconstitution of the angiotensin II type 2 receptor and G(i) activation.
11053482 2000 Polymorphism of angiotensin converting enzyme, angiotensinogen, and angiotensin II type 1 receptor genes and end-stage renal failure in IgA nephropathy: IGARAS--a study of 274 Men.
10710290 2000 Identification of an interaction between the angiotensin II receptor sub-type AT2 and the ErbB3 receptor, a member of the epidermal growth factor receptor family.
10406457 1999 Analysis of functional domains of angiotensin II type 2 receptor involved in apoptosis.
9884335 1999 Expression of the AT2 receptor developmentally programs extracellular signal-regulated kinase activity and influences fetal vascular growth.
9099917 1997 Genomic organization and polymorphism of human angiotensin II type 2 receptor: no evidence for its gene mutation in two families of human premature ovarian failure syndrome.
8957548 1996 Subtype 2 and atypical angiotensin receptors in the human heart.
8663053 1996 The AT2 receptor selectively associates with Gialpha2 and Gialpha3 in the rat fetus.
8552595 1996 Angiotensin II type 2 receptor mediates programmed cell death.
8502225 1993 Photoaffinity labeling of subtype 2 angiotensin receptor of human myometrium.
8185599 1994 Molecular cloning and expression of the gene encoding human angiotensin II type 2 receptor.
7999093 1994 Molecular cloning of the human angiotensin II type 2 receptor cDNA.
7945336 1994 Human type 2 angiotensin II receptor gene: cloned, mapped to the X chromosome, and its mRNA is expressed in the human lung.
7790004 1995 Assignment of the human angiotensin II type 2 receptor gene (AGTR2) to chromosome Xq22-q23 by fluorescence in situ hybridization.
7733925 1995 The sequence and genomic organization of the human type 2 angiotensin II receptor.
7719706 1994 Molecular characterization and chromosome localization of a human angiotensin II AT2 receptor gene highly expressed in fetal tissues.
7477267 1995 Effects on blood pressure and exploratory behaviour of mice lacking angiotensin II type-2 receptor.
7477266 1995 Behavioural and cardiovascular effects of disrupting the angiotensin II type-2 receptor in mice.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1550596 1992 Molecular cloning, sequence analysis and expression of a cDNA encoding human type-1 angiotensin II receptor.