Property Summary

NCBI Gene PubMed Count 12
PubMed Score 46.35
PubTator Score 10.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Nerve Degeneration 73
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.700 6.7e-03
oligodendroglioma -1.300 2.8e-02
glioblastoma multiforme -1.200 1.1e-14
osteosarcoma -2.128 1.4e-05
ependymoma -1.200 5.2e-09
non-small cell lung cancer -1.297 1.6e-21
lung adenocarcinoma -1.200 3.6e-15
ovarian cancer -1.100 2.5e-05

Gene RIF (2)

PMID Text
25381060 we identified seven new putative CCP1 substrates, all of them harboring acidic amino acids in their gene-encoded C terminus
23242554 Data indicate that a functional nuclear export signals (NESs) in CCP1 that mediates direct binding to the export receptor CRM1.

AA Sequence

MSKLKVIPEKSLTNNSRIVGLLAQLEKINAEPSESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEIL      1 - 70
LSTLENTKDLQTTLNILSILVELVSAGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILA     71 - 140
KIGPKDKKFGVKARINGALNITLNLVKQNLQNHRLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIG    141 - 210
PFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVT    211 - 280
NIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLPVIPVT    281 - 350
GPVAQLYSLPPEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIETDINKLKPQQEPGRTIEDLK    351 - 420
MYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKENISSKGDEGEK    421 - 490
KSTFMDLAKEDIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQNIPSQTAPGFTAEMKKDCSL    491 - 560
PLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY    561 - 630
IEIVKNTKSVPEYSEVAYPDYFGHIPPPFKEPILERPYGVQRTKIAQDIERLIHQSDIIDRVVYDLDNPN    631 - 700
YTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCE    701 - 770
KSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDD    771 - 840
VCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYEHICHFRNR    841 - 910
PYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNR    911 - 980
QWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNDNATSCDVVE    981 - 1050
DTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGT   1051 - 1120
RELEEMGAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAE   1121 - 1190
SNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP                                     1191 - 1226
//

Text Mined References (22)

PMID Year Title
25381060 2015 C-terminomics screen for natural substrates of cytosolic carboxypeptidase 1 reveals processing of acidic protein C termini.
23242554 2013 Identification of CRM1-dependent Nuclear Export Cargos Using Quantitative Mass Spectrometry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085998 2013 Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs).
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11884758 2002 Purkinje cell degeneration (pcd) phenotypes caused by mutations in the axotomy-induced gene, Nna1.
11083920 2000 Regenerating motor neurons express Nna1, a novel ATP/GTP-binding protein related to zinc carboxypeptidases.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.