Property Summary

NCBI Gene PubMed Count 996
PubMed Score 1711.33
PubTator Score 10892.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hypertension 396 6.918 3.5
Atherosclerosis 291 3.637 1.8
Albuminuria 21 0.0 0.0
Alkalosis 2 0.0 0.0
Allanson Pantzar McLeod syndrome 4 0.0 0.0
Anemia 365 0.0 0.0
Aneurysm, Dissecting 8 0.0 0.0
Anuria 9 0.0 0.0
Aortic Aneurysm, Abdominal 9 0.0 0.0
Aortic aneurysm 38 0.0 0.0
Arrhythmias, Cardiac 19 0.0 0.0
Bradycardia 36 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiomyopathy, Alcoholic 1 0.0 0.0
Cardiovascular Abnormalities 31 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Carotid Artery Diseases 11 0.0 0.0
Catalepsy 15 0.0 0.0
Cholestasis 155 0.0 0.0
Cognition Disorders 32 0.0 0.0
Death, Sudden 2 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Diabetic retinopathy 56 0.0 0.0
Drug Overdose 2 0.0 0.0
Endomyocardial Fibrosis 13 0.0 0.0
Essential Hypertension 94 0.0 0.0
Fetal Growth Retardation 189 0.0 0.0
Fibrosis 44 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Glomerulosclerosis, Focal Segmental 28 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart failure 162 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hyperemia 13 0.0 0.0
Hypertension, Malignant 3 0.0 0.0
Hypertension, Renal 3 0.0 0.0
Hypertrophy 17 0.0 0.0
Hypertrophy, Left Ventricular 24 0.0 0.0
Hypokalemia 52 0.0 0.0
Hypotension 82 0.0 0.0
Inflammation 120 0.0 0.0
Kidney Diseases 114 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Necrosis 53 0.0 0.0
Neointima 5 0.0 0.0
Nephrosis 21 0.0 0.0
Peptic Ulcer Hemorrhage 2 0.0 0.0
Pneumonia 174 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Proteinuria 144 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
RENAL TUBULAR DYSGENESIS 4 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinopathy of prematurity 22 0.0 0.0
Seizures 596 0.0 0.0
Thrombosis 46 0.0 0.0
Ureteral obstruction 33 0.0 0.0
Vascular Remodeling 3 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
Kidney Failure 111
Renal dysplasia 28

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -4.000 3.4e-08
Breast cancer 1.500 2.3e-03
Down syndrome 1.200 3.0e-03
esophageal adenocarcinoma 1.600 2.9e-02
gastric carcinoma 3.300 1.9e-02
group 3 medulloblastoma -3.300 6.8e-07
interstitial cystitis 1.700 9.2e-03
intraductal papillary-mucinous adenoma (... -1.600 1.6e-02
lung adenocarcinoma 1.500 2.2e-03
lung cancer 1.700 5.9e-03
lung carcinoma 1.800 1.8e-12
medulloblastoma, large-cell -3.400 6.5e-08
pancreatic cancer 1.300 4.6e-03
pituitary cancer -1.500 1.7e-02
primary pancreatic ductal adenocarcinoma 1.667 1.3e-03
primitive neuroectodermal tumor -2.700 1.2e-03
psoriasis -2.300 1.0e-03
subependymal giant cell astrocytoma -1.886 4.3e-03
ulcerative colitis 1.900 1.8e-05

Protein-protein Interaction (5)

PDB (12)

Gene RIF (1059)

AA Sequence

MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPA      1 - 70
PIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVF     71 - 140
GTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVG    141 - 210
VFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNT    211 - 280
YVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA    281 - 350
SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR    351 - 420
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA         421 - 485
//

Text Mined References (1002)

PMID Year Title