Property Summary

NCBI Gene PubMed Count 60
PubMed Score 515.15
PubTator Score 241.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 6.087 3.0
Disease Target Count Z-score Confidence
Anorexia nervosa 80 4.41 2.2
diabetes mellitus 1728 3.353 1.7
Hyperglycemia 137 3.049 1.5

Expression

Gene RIF (44)

AA Sequence

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL      1 - 70
AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT             71 - 132
//

Text Mined References (64)

PMID Year Title