Property Summary

NCBI Gene PubMed Count 60
PubMed Score 515.15
PubTator Score 241.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 6.087 3.0
Disease Target Count Z-score Confidence
Anorexia nervosa 80 4.41 2.2
diabetes mellitus 1728 3.353 1.7
Hyperglycemia 137 3.049 1.5

Expression

Synonym

Accession O00253 O15459 Q2TBD9
Symbols ART
AGRT
ASIP2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (44)

AA Sequence

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL      1 - 70
AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT             71 - 132
//

Text Mined References (64)

PMID Year Title