Property Summary

NCBI Gene PubMed Count 48
PubMed Score 541.95
PubTator Score 303.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.700 1.6e-05
astrocytoma 1.200 1.1e-02
glioblastoma 1.400 3.2e-05
juvenile dermatomyositis 1.515 3.9e-12
pancreatic ductal adenocarcinoma liver m... 2.005 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.7e-03
active ulcerative colitis 1.250 2.6e-02
Multiple Sclerosis 1.400 2.8e-03
pediatric high grade glioma 1.100 1.4e-04

Gene RIF (24)

PMID Text
25807640 In patients suffering from severe sepsis and septic shock, serum levels of C-terminal agrin fragment were significantly associated with kidney function and the need for renal replacement therapy and were not influenced by severe septic conditions.
25506919 Knockdown of agrin and perlecan promoted a decrease on cell migration and adhesion, and on resistance of cells to cisplatin.
25304331 Among 42 hip fractured patients (age 83.7+/-8.6 years, 76.2% women), sarcopenia was diagnosed in 7 individuals (16.7%). Serum C-terminal agrin fragment (CAF) levels were significantly higher in sarcopenic relative to non-sarcopenic patients.
24951643 Five new recessive mutations in the gene encoding agrin are identified in patients with congenital myasthenic syndrome.
24632822 these observations indicate that agrin is another autoantigen in patients with MG and agrin autoantibodies may be pathogenic through inhibition of agrin/LRP4/MuSK signaling at the NMJ.
24244707 MuSK myasthenia gravis IgG4 disrupts the interaction of LRP4 with MuSK but both IgG4 and IgG1-3 can disperse preformed agrin-independent AChR clusters
22423096 In contrast to wild-type neurons which form synapses and survive for prolonged periods, agrin-deficient neurons do not mature and are rapidly eliminated in the transgenic olfactory bulb.
22307776 Dynamics of expression patterns of agrin in human glioblastoma
22205389 study identifies a spontaneous agrin mutation that reduces the ability of z+ agrin to activate MuSK and induce AChR clustering; this results in a severe congenital myasthenic syndrome in the patient, with both pre- and postsynaptic defects at the neuromuscular junction
20471664 Agrin immunohistochemistry may facilitate determination of primary versus metastatic origin in problematic liver cancer cases.
19940118 different regions within the agrin protein are responsible for synapse formation at the neuromuscular junction and for process formation in central nervous system neurons
19631309 The agrin mutation does not interfere with its ability to induce postsynaptic structures but that it dramatically perturbs the maintenance of the neuromuscular junction.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19194276 agrin facilitates the discrimination of benign and malignant hepatocellular lesions
19166823 study concludes that Abeta can modulate the cellular expression of agrin and glypican-1, which may contribute to the accumulation of these heparan sulfate proteoglycans in Alzheimer's disease lesions
18025246 The agrin expression in human T cells is regulated by cell activation and IFN-alpha, and may have an important function during cell activation with potential implications for autoimmunity.
17640714 agrin might play an important role in neoangiogenesis in human HCC, being a part of the newly formed vasculature. In CC, however, agrin might be involved in tumor progression
16487930 In human sperm an agrin isoform with a short NH2-terminus (agrinSN) localized in the posterior post-acrosomal, neck, and flagellar mid-piece regions.
16037493 agrin has a role in binding alpha-synuclein and modulating alpha-synuclein fibrillation
15694127 in the NtA-laminin complex, conserved amino acids in the gamma 1 chain are prerequisite for the binding to agrin
15691710 Thus, an agrin/MuSK complex may form part of a motor neuron stop signal involved in "reverse signaling" to the motor neuron.
12270958 evidence for additional functions of agrin during axonal growth, establishment of the blood-brain barrier, and Alzheimer's disease is accumulating--REVIEW
12073527 acts at the nerve-muscle synapse in the glomerular basal membrane and on T-lymphocytes
12070669 Agrin, a heparan sulfate proteoglycan, is a component of the basal lamina of BBB microvessels, and growing evidence suggests that it may be important for the maintenance of the BBB.

AA Sequence

MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRV      1 - 70
WRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMR     71 - 140
ITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVC    141 - 210
GSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAP    211 - 280
EGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCP    281 - 350
ARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVT    351 - 420
CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC    421 - 490
LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCVCPSECV    491 - 560
ALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGP    561 - 630
VCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSED    631 - 700
GPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP    701 - 770
YGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG    771 - 840
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGA    841 - 910
RCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPT    911 - 980
SASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVPPTAPSPAP    981 - 1050
SLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPS   1051 - 1120
LDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVR   1121 - 1190
LRDLGPGKSVRAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGA   1191 - 1260
TSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPP   1261 - 1330
KPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRAYHTLRLALEF   1331 - 1400
RALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSV   1401 - 1470
DGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAAT   1471 - 1540
RGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGG   1541 - 1610
AQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYN   1611 - 1680
GQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGES   1681 - 1750
PKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGH   1751 - 1820
PCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESEL   1821 - 1890
ANEIPVPETLDSGALHEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQP   1891 - 1960
VVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKA   1961 - 2030
YGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP                                    2031 - 2067
//

Text Mined References (53)

PMID Year Title
25807640 2015 C-terminal agrin fragment (CAF) reflects renal function in patients suffering from severe sepsis or septic shock.
25506919 2014 Agrin and perlecan mediate tumorigenic processes in oral squamous cell carcinoma.
25304331 2014 Serum levels of C-terminal agrin fragment (CAF) are associated with sarcopenia in older hip fractured patients.
24951643 2014 Agrin mutations lead to a congenital myasthenic syndrome with distal muscle weakness and atrophy.
24632822 2014 Autoantibodies to agrin in myasthenia gravis patients.
24244707 2013 MuSK myasthenia gravis IgG4 disrupts the interaction of LRP4 with MuSK but both IgG4 and IgG1-3 can disperse preformed agrin-independent AChR clusters.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22683512 2013 C-terminal Agrin Fragment as a potential marker for sarcopenia caused by degeneration of the neuromuscular junction.
22423096 2012 Agrin-signaling is necessary for the integration of newly generated neurons in the adult olfactory bulb.
22307776 2012 Dynamics of expression patterns of AQP4, dystroglycan, agrin and matrix metalloproteinases in human glioblastoma.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22205389 2012 LG2 agrin mutation causing severe congenital myasthenic syndrome mimics functional characteristics of non-neural (z-) agrin.
21969364 2011 Agrin binds to the N-terminal region of Lrp4 protein and stimulates association between Lrp4 and the first immunoglobulin-like domain in muscle-specific kinase (MuSK).
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20471664 2010 Agrin immunohistochemistry facilitates the determination of primary versus metastatic origin of liver carcinomas.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19940118 2010 The process-inducing activity of transmembrane agrin requires follistatin-like domains.
19631309 2009 Identification of an agrin mutation that causes congenital myasthenia and affects synapse function.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19194276 2009 Agrin and CD34 immunohistochemistry for the discrimination of benign versus malignant hepatocellular lesions.
19166823 2009 Amyloid beta induces cellular relocalization and production of agrin and glypican-1.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18025246 2007 Agrin signalling contributes to cell activation and is overexpressed in T lymphocytes from lupus patients.
17640714 2007 Comparison of the expression of agrin, a basement membrane heparan sulfate proteoglycan, in cholangiocarcinoma and hepatocellular carcinoma.
17628813 2007 MLC1 is associated with the dystrophin-glycoprotein complex at astrocytic endfeet.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16487930 2006 Identification of agrinSN isoform and muscle-specific receptor tyrosine kinase (MuSK) [corrected] in sperm.
16106752 2005 Vector-capping: a simple method for preparing a high-quality full-length cDNA library.
16037493 2005 Agrin binds alpha-synuclein and modulates alpha-synuclein fibrillation.
15694127 2005 Structure and laminin-binding specificity of the NtA domain expressed in eukaryotic cells.
15691710 2005 Motor neurite outgrowth is selectively inhibited by cell surface MuSK and agrin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340048 2004 A single pulse of agrin triggers a pathway that acts to cluster acetylcholine receptors.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270958 2002 Agrin in the developing CNS: new roles for a synapse organizer.
12073527 2002 [Agrin acts at the nerve-muscle synapse in the glomerular basal membrane and on T-lymphocytes].
12070669 2002 Extracellular matrix and the blood-brain barrier in glioblastoma multiforme: spatial segregation of tenascin and agrin.
11161480 2001 An alternative amino-terminus expressed in the central nervous system converts agrin to a type II transmembrane protein.
9652404 1998 Primary structure and high expression of human agrin in basement membranes of adult lung and kidney.
9417121 1998 Agrin is a high-affinity binding protein of dystroglycan in non-muscle tissue.
9405491 1998 Agrin is a major heparan sulfate proteoglycan in the human glomerular basement membrane.
9151673 1997 Agrin binds to the nerve-muscle basal lamina via laminin.
8617505 1996 The I.M.A.G.E. Consortium: an integrated molecular analysis of genomes and their expression.
1851019 1991 Structure and expression of a rat agrin.
1659950 1991 Agrin mediates cell contact-induced acetylcholine receptor clustering.
1326608 1992 Structure and chromosomal localization of the mammalian agrin gene.