Property Summary

NCBI Gene PubMed Count 27
PubMed Score 7.85
PubTator Score 16.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 1.4e-06
osteosarcoma 7933 1.1e-04
psoriasis 6685 1.4e-04

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.200 1.4e-04
osteosarcoma 1.260 1.1e-04
tuberculosis 1.200 1.4e-06

Protein-protein Interaction (5)

Gene RIF (4)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17707131 Results suggest that motifs II and III of 1-acyl-sn-glycero-3-phosphate acyltransferase 1 are involved in lysophosphatidic acid binding, and motifs I and IV are involved in acyl-CoA binding.
16571775 The differences in expression of AGPAT1 in human monocytes and macrophages, and its effect on platelet-activating factor in these cells is reported.

AA Sequence

MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILR      1 - 70
LMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACW     71 - 140
LAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVM    141 - 210
SSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG    211 - 280
GGG                                                                       281 - 283
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21873652 2011 Human 1-acylglycerol-3-phosphate O-acyltransferase isoforms 1 and 2: biochemical characterization and inability to rescue hepatic steatosis in Agpat2(-/-) gene lipodystrophic mice.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
19946888 2010 Defining the membrane proteome of NK cells.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
17707131 2007 Topology of acyltransferase motifs and substrate specificity and accessibility in 1-acyl-sn-glycero-3-phosphate acyltransferase 1.
16870193 2007 Sustained elevations in NEFA induce cyclooxygenase-2 activity and potentiate THP-1 macrophage foam cell formation.
16571775 2006 Lysophospholipid transacetylase in the regulation of PAF levels in human monocytes and macrophages.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11487472 2001 The structure and functions of human lysophosphatidic acid acyltransferases.
9461603 1998 Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex.
9450025 1997 Human lysophosphatidic acid acyltransferase is encoded by a gene located in the major histocompatibility complex.
9291118 1997 A human cDNA sequence with homology to non-mammalian lysophosphatidic acid acyltransferases.
9212163 1997 Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8944226 1996 Biosynthesis of triacylglycerols.
8619474 1996 A "double adaptor" method for improved shotgun library construction.