Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.70
PubTator Score 16.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.800 1.4e-02
pancreatic cancer 1.100 1.1e-03
astrocytic glioma 1.700 1.3e-02
osteosarcoma 1.510 2.4e-06
atypical teratoid / rhabdoid tumor 1.600 9.3e-04
glioblastoma -1.200 3.5e-03
medulloblastoma, large-cell -1.400 4.9e-04
tuberculosis and treatment for 6 months -1.100 1.7e-02
pancreatic carcinoma 1.100 1.1e-03
psoriasis -1.100 1.6e-09
Pick disease 2.100 1.0e-05
pituitary cancer -1.600 8.9e-04

 IMPC Phenotype (1)

Gene RIF (9)

PMID Text
24100239 Study uncovers a first example of a vertebrate protein factor, Argonaute-3, specifically affecting the guide-to-passenger-strand ratio of the miRNA let-7a. A multi-layered mechanism for the observed impact of Ago3 on the let-7a-3p passenger strand expression and activity is proposed.
23748378 The Ago3 PIWI domain is slicing competent but our Ago3 model suggests multiple interactions between residues in the PIWI & N domains that may increase protein rigidity or invoke other properties that contribute to Ago3's observed slicing deficiency.
23665583 The N-terminal domain of Ago3 inhibits cleavage activity. AAs 1-64 are largely unstructured & form a large loop surrounding an area containing two helices & another unstructured loop.
23064648 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22474261 Ago3 is able to load microRNAs efficiently in the absence of Ago1 and Ago2, despite a significant loss of global microRNA expression
21634124 reliable predictions of miRNA affinity to Ago2 AND Ago3 proteins were made.
19393748 EIF@C3 protein is expressed in both Schwann and neuron-type differentiating cells.
18771919 The specificity of RNA interference depends on the concentration of Ago1, Ago3, and Ago4 relative to Ago2.
18187620 Knockdown of eukaryotic translation initiation factor 2C, 3 (EIF2C3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSM      1 - 70
VQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVL     71 - 140
TGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPA    141 - 210
MWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKY    211 - 280
RVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAG    281 - 350
QRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ    351 - 420
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQP    421 - 490
CFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQT    491 - 560
LSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATV    561 - 630
RVQRPRQEIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQ    631 - 700
PGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLW    701 - 770
DDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP    771 - 840
QALAKAVQIHQDTLRTMYFA                                                      841 - 860
//

Text Mined References (29)

PMID Year Title
24100239 2013 Argonaute-3 activates the let-7a passenger strand microRNA.
23748378 2013 Molecular dissection of human Argonaute proteins by DNA shuffling.
23665583 2013 Turning catalytically inactive human Argonaute proteins into active slicer enzymes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064648 2012 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795694 2012 Slicing-independent RISC activation requires the argonaute PAZ domain.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22474261 2012 Quantitative functions of Argonaute proteins in mammalian development.
21634124 [The nucleotide sequence features of the mature microRNA seem to be responsible for the affinity to human Ago2 AND Ago3 proteins].
19966796 2010 ATP-dependent human RISC assembly pathways.
19946888 2010 Defining the membrane proteome of NK cells.
19393748 2009 Differential expression of Dicer and Argonaute genes during the differentiation of human neuroblastoma cells.
19383768 2009 The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.
19324964 2009 The C-terminal half of human Ago2 binds to multiple GW-rich regions of GW182 and requires GW182 to mediate silencing.
19167051 2009 Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.
18771919 2008 Importance of translation and nonnucleolytic ago proteins for on-target RNA interference.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16081698 2005 Inhibition of translational initiation by Let-7 MicroRNA in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260970 2004 Human Argonaute2 mediates RNA cleavage targeted by miRNAs and siRNAs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12906857 2003 Identification of eight members of the Argonaute family in the human genome.
12526743 2003 Short-interfering-RNA-mediated gene silencing in mammalian cells requires Dicer and eIF2C translation initiation factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414724 2002 The Argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.