Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.79
PubTator Score 19.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
nephrosclerosis -2.220 2.3e-02
malignant mesothelioma 3.800 1.1e-08
astrocytic glioma -1.700 2.1e-02
ependymoma -2.100 2.4e-02
oligodendroglioma -1.900 1.9e-02
Barrett's esophagus 1.900 3.9e-02
esophageal adenocarcinoma 2.500 1.8e-02
cutaneous lupus erythematosus 1.900 8.6e-03
osteosarcoma -1.453 6.5e-04
cystic fibrosis 1.219 4.5e-05
atypical teratoid / rhabdoid tumor -1.700 5.5e-05
glioblastoma -1.100 5.1e-03
medulloblastoma -1.600 3.4e-05
medulloblastoma, large-cell -1.700 2.2e-03
primitive neuroectodermal tumor -1.700 2.9e-04
Duchenne muscular dystrophy -1.057 5.0e-05
acute quadriplegic myopathy -1.490 8.1e-05
limb girdle muscular dystrophy 2A -1.039 9.2e-05
pancreatic ductal adenocarcinoma liver m... -2.527 1.8e-04
tuberculosis 1.300 1.5e-03
non-small cell lung cancer 1.009 1.1e-09
intraductal papillary-mucinous adenoma (... 1.400 3.1e-02
intraductal papillary-mucinous carcinoma... 2.800 4.8e-04
intraductal papillary-mucinous neoplasm ... 2.500 3.5e-03
lung cancer 2.900 1.3e-03
gastric carcinoma 2.500 5.0e-02
ovarian cancer 1.700 3.5e-05

Gene RIF (10)

PMID Text
24663101 Depletion of the AGMAT expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
23740519 Enzymes that are directly involved in the formation of urea are expressed in ocular tissues.
21803059 This study demonistrated that increased expression of agmatinase in hippocampal interneurons of subjects with mood disorders.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20563878 Agmatinase activity was predominantly detected in neurons of rat and human brain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16511187 X-ray crystallographic analysis of human agmatinase
14648699 Agmatinase is down-regulated in the clear cell type of renal cell carcinoma
11804860 an alternative to ornithine decarboxylase for polyamine biosynthesis

AA Sequence

MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEG      1 - 70
LDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRR     71 - 140
IQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVD    141 - 210
EGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDAL    211 - 280
DPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVT    281 - 350
TV                                                                        351 - 352
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740519 2013 Enzymes of urea synthesis are expressed at the ocular surface, and decreased urea in the tear fluid is associated with dry-eye syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21803059 2012 Agmatinase, an inactivator of the putative endogenous antidepressant agmatine, is strongly upregulated in hippocampal interneurons of subjects with mood disorders.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20563878 2011 The agmatine-degrading enzyme agmatinase: a key to agmatine signaling in rat and human brain?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16511187 2005 Expression, crystallization and preliminary X-ray crystallographic analysis of human agmatinase.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028567 2003 Vertebrate agmatinases: what role do they play in agmatine catabolism?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14648699 2004 Human agmatinase is diminished in the clear cell type of renal cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11914032 2002 Cloning and characterization of human agmatinase.
11804860 2002 Cloning of human agmatinase. An alternate path for polyamine synthesis induced in liver by hepatitis B virus.
9758718 1998 Differential gene expression in apoptosis: identification of ribosomal protein 23K, a cell proliferation inhibitor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.