Property Summary

NCBI Gene PubMed Count 25
PubMed Score 67.79
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 1.2e-03
non primary Sjogren syndrome sicca -1.200 2.4e-02
ovarian cancer 1.600 2.9e-04
pituitary cancer 1.200 5.0e-06

Protein-protein Interaction (9)

Gene RIF (16)

PMID Text
25960215 miR-194 could reduce the phosphoinositide 3-kinase (PI3K)/AKT/FoxO3a signaling pathway by suppressing acylglycerol kinase (AGK) directly.
25872568 AGK promotes the proliferation and cell cycle progression of oral squamous cell carcinoma.
25474138 findings provide new evidence that AGK plays an important role in promoting angiogenesis and providing resistance to apoptosis in hepatocellular carcinoma
25208612 compare our findings to those in 21 previously reported AGK mutation-positive Sengers patients, confirming that Sengers syndrome is a clinically recognisable disorder of mitochondrial energy metabolism
24886245 AGK promotes cell proliferation and tumorigenicity in breast cancer via suppression of the FOXO1.
23676499 AGK expression was significantly correlated with JAK2/STAT3 hyperactivation in esophageal squamous cell carcinoma, as well as in lung and breast cancer.
23266196 study reports 2 families with Sengers syndrome and mutations in the acylglycerol kinase gene; 1 proband had abnormal mitochondria with citrate synthase crystals, associated with high citrate synthase activity; these pedigrees confirm that mutation of AGK is responsible for the severe neonatal presentation of Sengers syndrome
22864860 Our findings suggest that ATX-AGK-LPA signaling axis might be an important player in the development and progression of diabetic retinopathy.
22415731 This is the first mutation in AGK gene to be implicated in the development of isolated cataract.
22284826 The loss of AGK led to a decrease of the adenine nucleotide translocator in the inner mitochondrial membrane in muscle.
22284826 Lack of the AGK causes Sengers syndrome
22277967 Recessive mutations in AGK cause mitochondrial DNA depletion
20877624 Observational study of gene-disease association. (HuGE Navigator)
19549252 High Expression of acylglycerol kinase is associated with development and progression of prostate cancer.
18004883 The chiral specificity of diacylglycerol kinase alpha, zeta & epsilon mimics the substrate specificity, with MuLK being the least selective and the epsilon isoform of diacylglycerol kinase exhibiting the greatest selectivity.
15252046 identification and characterization of a novel lipid kinase that phosphorylates multiple substrates, MuLK

AA Sequence

MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPA      1 - 70
ACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTD     71 - 140
EATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKEQPVFAMTGLR    141 - 210
WGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRIL    211 - 280
RRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGS    281 - 350
RKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP    351 - 420
TQ                                                                        421 - 422
//

Text Mined References (30)

PMID Year Title
25960215 2015 miR-194 regulated AGK and inhibited cell proliferation of oral squamous cell carcinoma by reducing PI3K-Akt-FoxO3a signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872568 2015 Acylglycerol kinase promotes the proliferation and cell cycle progression of oral squamous cell carcinoma.
25474138 2014 AGK enhances angiogenesis and inhibits apoptosis via activation of the NF-?B signaling pathway in hepatocellular carcinoma.
25208612 2014 Sengers syndrome: six novel AGK mutations in seven new families and review of the phenotypic and mutational spectrum of 29 patients.
24886245 2014 Acylglycerol kinase promotes cell proliferation and tumorigenicity in breast cancer via suppression of the FOXO1 transcription factor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23676499 2013 Acylglycerol kinase augments JAK2/STAT3 signaling in esophageal squamous cells.
23266196 2013 Mitochondrial citrate synthase crystals: novel finding in Sengers syndrome caused by acylglycerol kinase (AGK) mutations.
22864860 2013 Expression of lysophosphatidic acid, autotaxin and acylglycerol kinase as biomarkers in diabetic retinopathy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22415731 2012 Identification of a truncation mutation of acylglycerol kinase (AGK) gene in a novel autosomal recessive cataract locus.
22284826 2012 Lack of the mitochondrial protein acylglycerol kinase causes Sengers syndrome.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19549252 2009 Expression of autotaxin and acylglycerol kinase in prostate cancer: association with cancer development and progression.
18004883 2007 Substrate chirality and specificity of diacylglycerol kinases and the multisubstrate lipid kinase.
17135245 2007 Functions of the multifaceted family of sphingosine kinases and some close relatives.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269826 2006 Further characterization of mammalian ceramide kinase: substrate delivery and (stereo)specificity, tissue distribution, and subcellular localization studies.
15939762 2005 A novel acylglycerol kinase that produces lysophosphatidic acid modulates cross talk with EGFR in prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252046 2004 MuLK, a eukaryotic multi-substrate lipid kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.