Property Summary

NCBI Gene PubMed Count 676
PubMed Score 173.71
PubTator Score 748.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 1.5e-04
psoriasis -1.200 1.3e-03
osteosarcoma -2.083 1.3e-06
glioblastoma -1.100 4.3e-04
non-small cell lung cancer -5.703 4.8e-43
lung cancer -3.800 3.2e-06
lung adenocarcinoma -5.400 5.7e-23
adult high grade glioma -1.200 1.2e-03
lung carcinoma -4.400 6.7e-41

Protein-protein Interaction (4)

Gene RIF (637)

PMID Text
27026438 Multi-walled carbon nanotube induces injury or necrosis of lung epithelial cells and DNA damage via HMGB1/RAGE/TLR9 pathway.
27015414 RAGE and TGF-beta1 are both involved in fibrosis development in a complex cross-talk mechanism, while also acting on their own individual targets
26905625 Study indicates a role for S100A12, CML, and RAGE in peripheral arterial disease complications by activation of the RAGE system.
26880860 High and transient levels of IL-6 and methylglyoxal characterize the early immune response after trauma, whereas samples from later time points provide evidence for a secondary release of RAGE ligands. Our results provide evidence for a persisting activation of the RAGE axis while classical mediators like IL-6 disappear early.
26873694 These results indicate that RAGE may be a potential trigger in microvascular formation and proliferation in the development of endometrial cancer.
26828298 the G82S polymorphism in RAGE is associated with increased DRE risk and that the GS genotype of the G82S locus is a risk factor for drug-resistant epilepsy in the Chinese population.
26825459 AGER and its functions to stimulate O-GlcNAcylation are important during liver tumorigenesis, when high blood glucose levels are inadequately controlled.
26788516 In coronary artery disease patients RAGE may be involved in promoting epicardial adipose tissue adiposity and metabolic dysfunction, such as impaired insulin signaling.
26782577 There was no association between AGER gene polymorphisms and ulcerative colitis susceptibility in the Chinese Han population.
26782423 In conclusion, these data indicated that common polymorphisms in the AGER gene might increase the risks of breast (BC) and lung (LC) cancer .
26770981 Our study indicated that the 2184A/G polymorphism in the RAGE gene was significantly associated with diabetic nephropathy in Chinese Han patients with type 2 diabetes.
26758977 PRAK might be a potential therapeutic target of Alzheimer's disease involved in receptor for advanced glycation end products-mediated cell signaling induced by Abeta
26745632 The RAGE gene may be involved in the pathogenesis of MCI in type 2 diabetes mellitus patients, and the Gly82Ser polymorphism could be in linkage disequilibrium with the actual gene variants related to the disease.
26682535 We conclude that placental RAGE is activated during preeclampsia and that RAGE-mediated inflammation in the trophoblast involves increased pro-inflammatory cytokine secretion.
26664786 Single nucleotide polymorphisms (SNPs) rs1035798 in RAGE gene, rs2073617 and rs2073618 in TNFRSF11B, and rs3732410 in Golgb1 will be investigated on whether there is an association with hemorrhagic stroke (HS) in Chinese population.
26657980 increased plasma level of soluble RAGE is a better indicator of renal function decline in diabetic CKD patients instead of non-diabetic CKD patients
26586913 Data suggest stimulation of signal transduction via AGER agonists AGE (advanced glycation end products) up-regulates both autophagy and accumulation of lipid droplets (that are not cleared effectively by autophagy); this mechanism could promote obesity.
26569122 Serum levels of sRAGE were negatively correlated with body measurements indicative of obesity in the prediabetic state.
26545872 This present study confirmed an important role of RAGE in vivo and vitro models of pulmonary fibrosis and suggested the therapeutic possibility for pulmonary fibrosis via RAGE regulation
26502815 Study confirms the involvement of HLA class III (HSP70, RAGE, TNF) in Alzheimer's Disease
26491690 activation of RAGE may influence the pathogenesis and reflection in sRAGE levels in acute and stable CAD differently
26472922 low concentration of AGE-BSA activated the Raf/MEK/ERK signal pathway through the interaction with RAGE, induced autophagy, and regulated the proliferation and function of hFOB1.19 cells
26456846 Genotyping of a Euro-Brazilian population of children and adolescents with type 1 diabetes showed no significant differences in the -429T>C, -374T>A and 63 bp deletion/insertion (-407 to -345 bp) in RAGE promotor when compared to control.
26436377 the investigated polymorphism in the RAGE gene play a role in osteoarthritis in the Han Chinese population.
26429324 Our data suggest that the presence of the A allele of -374 T/A polymorphism in the RAGE gene has a protective effect against stroke.
26408307 The results show a possible protective effect of high levels of sRAGE at baseline against inflammation 5 years later, but not on arterial stiffness or wall thickness, in this cohort of adolescents and young adults with T1D.
26392152 Data suggest that, at least in the very short term (one day), dietary intake of N(epsilon)-carboxymethyl-lysine/advanced glycation end products alone is not very important to serum levels of soluble RAGE and other biomarkers of inflammation.
26391982 HMGB1 and RAGE interaction may contribute to the inflammation of liver enhancing the expression of IL-17, which can be possibly restored through the decline of the HMGB1/RAGE axis in hepatitis B patients
26382057 Reduced expression of membrane-bound AGER is a biomarker of multiple sclerosis disease progression.
26349055 preliminary evidence in a Chinese population that the RAGE polymorphism is involved in genetic susceptibility to ulcerative colitis
26325204 Serum ADAM10 level was increased in type 1 diabetes and was a significant determinant of circulating cRAGE
26316588 Identify RAGE as a target of miR-185 in esophageal squamous cell carcinoma.
26313784 RAGE gene polymorphism rs1800625 correlate with the early stage of liver tumorigenesis and implicate its protective role in the progression of Hepatocellular Carcinoma.
26303759 Compared with matched control placentas, the mRNA levels of HMGB1, RAGE and NF-kappaB p65 were increased in severe preeclamptic placentas.
26274928 This is the first kinetics study of levels of RAGE main isoforms and ligands during ARDS. Elevated sRAGE, HMGB1 and S100A12, with decreased esRAGE and AGEs, were found to distinguish patients with ARDS from those without.
26261503 HMGB1/RAGE exhibited significantly elevated expression in renal cancer tissues that was closely related to the clinical prognosis of patients
26253613 Data suggest that ligand-induced activation of RAGE down-regulates ABCG1- (ATP binding cassette subfamily G 1-) mediated cholesterol efflux from macrophages leading to diabetic angiopathies and atherosclerotic plaques.
26226616 data suggest that the minor (T) allele of rs1035798:C>T represents an independent susceptibility factor for CV death. The expression of AGER isoforms is different in atheroma from patients with recent symptoms
26216409 Suggest activation of the receptor for advanced glycation end products (RAGE) could be one additional mechanism for accelerated peripheral arterial disease and increased risk for amputation and death in type 2 diabetics.
26211596 Elevate RAGE expression was correlated with decreased overall survival in clear cell renal cell carcinoma patients.
26202300 up-regulated during platelet activation; binds high mobility group box 1 expressed in coronary artery thrombi
26193421 S100P/RAGE signaling pathway regulates expression of microRNA-21 in colon cancer cells
26142969 Serum RAGE and glycosylated serum albumin are novel predictors of long-term clinical outcomes in patients with type 2 diabetes and stable coronary artery disease.
26125438 APE1/Ref-1 is extracellularly secreted and triggers apoptosis in triple-negative breast cancer cells via RAGE binding, which is mediated through acetylation
26114112 our results suggest that AGEs enhance macrophage differentiation into proinflammatory M1 phenotype at least partly via RAGE/NF-kappaB pathway activation.
26083729 The rs2070600 SNP, a coding variant in the AGER gene, is a likely causal determinant of sRAGE levels, but genetic variation in AGER does not appear to explain black-white difference in sRAGE.
26078977 Data suggest that serum sRAGE levels do not correlate with insulin resistance (IR) in subjects with prediabetes compared to control subjects; serum sRAGE levels do not correlate with IR and beta-cell dysfunction during development of type 2 diabetes.
26052716 human SAA is possibly only expressed in a subset of septic patients; SAA induces HMGB1 release via TLR4 and RAGE receptors; SAA supplementation worsens the outcome of lethal endotoxemia
26048613 The findings of this study strengthen the concept of unique interactions between degenerative and inflammatory mechanisms and suggest that HMGB1/RAGE signaling is a critical pathway in inclusion body myositis pathology.
26045736 Suggest that advanced glycation end products and their receptor have important roles in the pathophysiology of pelvic organ prolapse.
26018980 The soluble forms of RAGE and variants in its genetic locus are prognostic markers.
26011358 The polymorphism of rs2070600 in the RAGE gene may increase the susceptibility to several human cancers, especially to lung cancer and to Asians. The rs1800264 most likely contributes to decreased susceptibility to breast cancer but increased susceptibility to lung cancer (Meta-Analysis)
26011179 Human HD brains had a high degree of co-localization of RAGE with its putative ligands in the caudate nucleus and the subependymal layer. Co-staining for both RAGE-S100B and RAGE-CML was the highest in the astrocytes but was low in neurons and microglia.
25994997 serum esRAGE levels inversely associated with blood pressure, in male nondiabetic patients with obstructive sleep apnea
25974999 sRAGE levels do not reflect increased salvage index in acute myocardial infarction patients who received remote ischaemic conditioning prior to hospital admission
25966147 sRAGE, potential marker of atherosclerosis, might have a role in the development of aortic valve calcification.
25956266 Report elevated AGEs levels with concomitant decreased sRAGE levels in active adult-onset Still's disease patients.
25932660 Soluble receptor for advanced glycation end-products (sRAGE) is a marker of alveolar type I cell injury. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201501-0020OC#.Vh3kYtKFPyA
25854354 High mRNA expression of RAGE is associated with bladder transitional cell carcinoma.
25832424 CRP stimulated the expression of RAGE in coronary artery endothelial cells, accompanied by markedly increased ROS generation, phosphorylation of ERK1/2 and NF-kappaB p65, as well as translocation of NF-kappaB p65 to the nuclei.
25825217 serum level elevated in acute liver failure
25811984 We hypothesize that RAGE and S100A8/A9 contribute to the development of human SCC by modulating keratinocyte growth and migration.
25802195 Anti-inflammatory soluble RAGE might be a potential future biomarker to predict weight loss.
25789318 study provides preliminary evidence that the 82S allele of RAGE is a risk factor for abdominal aortic aneurysms
25786107 the involvement of AGEs in the development and progression of type 2 diabetes mellitus
25772690 RAGE expression positively correlated with chronic rhinisinusitis severity and a positive history for allergies.
25754382 This strongly suggests a role for RAGE in contributing to the inflammatory overdrive seen in CF and to a greater extent in CFRD.
25751734 Phosphatidylethanolamine modification by IsoLG forms receptor for advanced glycation endproducts ligands that activates macrophages, the increased IsoLG-PE generated may play a role in the inflammation associated with these conditions.
25751601 Study describes evidence for the role of HMGB1-RAGE and the HMGB1-TLR4 axis associated with pulmonary dysfunction and central nervous system injury. [review]
25744702 sRAGE levels were not associated with carotid atherosclerosis.
25744544 The data have identified the RAGE/Dia-1 signaling system as a mediator for the pro-migratory response of extracellular S100A4 in human thyroid cancer cells.
25724694 intracellular levels of IGF-1 and RAGE protein might regulate the final destiny of the ovarian cell populations prior and during folliculogenesis, possibly controlling the metastatic potential of OSC as well.
25707513 The RAGE gene -429CC genotype might be a risk factor for DN in patients with type 2 diabetes.
25689357 This study proposed a hypothetic model to illustrate that impaired glucose metabolism in AD brain may increase the expression of splicing protein hnRNP A1 and reduce Tra2beta-1, which cause the imbalanced expression of mRAGE and esRAGE.
25684181 Nuclear DNA-HMGB1-histone complexes as DAMP complexes selectively induce cell death in macrophages, but not cancer cells. The process is madiated by RAGE.
25681682 these data suggest that although genetically determined to a substantial degree, the sRAGE levels also depend on age and obesity, which in turn, increase the risk for a variety of pathological conditions associated with sRAGE
25671828 Early on after liver transplantation, there is accumulation of N(epsilon)-carboxy-methyl-lysine adduct and a rapid increase of HMGB1 concurrent with a remarkable decline in circulating sRAGE.
25652880 Blocking RAGEHMGB1 interaction with antibody or siRNA suppressed the ERK1/2 activation and gastric cancer cell growth, indicating that RAGE-mediated ERK1/2 signaling was necessary for tumor progression.
25607269 sRAGE levels are associated with worse outcomes in patients with septic shock; statistical correlation analysis with other proinflammatory cytokines indicated that the pathways leading to those outcomes are different depending on sRAGE levels
25603950 this meta-analysis revealed that the advanced glycation end products 82G/S polymorphism is associated with a significantly increased risk of cancer, while -374T/A polymorphism is associated with a reduced risk of cancers.
25593504 RAGE expression is upregulated in vascular endothelial cells in pterygium. RAGE upregulation is an important mechanism by which endothelial cells amplify the overall inflammatory response.
25582438 results indicate involvement of RAGE SNP rs1800625 in development of oral squamous cell carcinoma and implicate interaction between RAGE gene polymorphisms and environmental mutagens as predisposing factor of oral carcinogenesis.
25572331 found that RAGE/S100A7 conditioned the tumor microenvironment by driving the recruitment of MMP9-positive tumor-associated macrophages
25572180 The results indicated that rs1800625 was significantly associated with sepsis morbidity rate and MODS in patients with major trauma in the Chongqing, Zhejiang and Yunnan districts.
25562186 In the early phase after acute myocardial infarction and percutaneous coronary intervention, sRAGE levels were high.
25531888 Our data provide evidence that RAGE mediates oxLDL-induced activation of p38 and JNK MAPK and the osteogenic differentiation of VICs.
25509346 These studies are also needed for the development of novel medications that target receptor for advanced glycation end products and signaling mechanisms that this receptor activates.
25503556 elevated expression is associated with increased disease severity, as well as allergy and aspirin exacerbated respiratory disease in patients with recalcitrant chronic rhinosinusitis with nasal polyps
25499973 Data suggest sRAGE/AGER is not associated with atrial fibrillation after adjustment for cardiovascular risk factors; sRAGE is inversely associated with inflammation at baseline, but is not associated with future elevations in inflammatory markers.
25490770 RAGE/MT1-MMP axis modified HMBG-1-mediated TF expression through RhoA and Rac1 activation and NF-kappaB phosphorylation in endothelial cells
25470016 In this review, the pathophysiological role of RAGE in both diabetic and nondiabetic renal diseases is discussed.
25467215 Skin AGE and sRAGE levels are elevated in T1DM patients compared with healthy controls. No difference in skin sRAGE levels between T1DM patients with or without CD were observed.
25428166 RAGE is a crucial leukocyte adhesion molecule in both preterm and term infants.
25407489 The connection of RAGE -429T/C and 2184A/G SNPs with the aggressiveness of the tumor.
25385222 HMGB1 signaling engages multiple activation pathways in RAGE-positive keratinocytes.
25355250 Serum sRAGE was elevated in children with bronchiolitis.
25341034 Binding of RAGE to oncogenic KRAS facilitates hypoxia-inducible factor 1 (HIF1)alpha activation and promotes pancreatic tumor growth under hypoxic conditions.
25330185 Our findings demonstrate the importance of AGE-RAGE with regard to the malignancy of oral cancer, and help to explain the poor prognosis of DM subjects with oral cancer
25310905 Tumor growth was significantly reduced when the mice were treated with anti-RAGE antibodies, suggesting that RAGE, and probably several S100 proteins, were involved in tumor growth.
25231638 Elevated level of circulating sRAGE is associated with the presence of bicuspid aortic valve and associated aortopathies, independent of aortic diameter.
25223881 this study assessed the possible interactions between TLR4 and RAGE signalling on apoptosis and on the expression of inflammatory cytokines in PBMC from individuals with and without diabetes.
25186179 These data suggest that the HMGB1-RAGE axis plays a role in the mechanism by which traumatic brain injury induces lung dysfunction.
25147225 High plasma levels of soluble receptor for advanced glycation end products are associated with kidney disease.
25136083 RAGE inhibits the release of HIV-1 in terms of reduced levels of CA in virus particles and induces the accumulation of cell-associated CA
25123133 Low RAGE activity in embryonal rhabdomyosarcoma cells results in high PAX7 levels that sustain migration and invasiveness.
25114379 The findings suggest that RAGE and HMGB1 play an important role in the pulpal immune response to oral bacterial infection.
25044082 Elevated levels of serum sRAGE are associated with recurrent pregnancy losses (RPL). The soluble receptor for advanced glycation end products might contribute to RPL by reducing uterine blood flow and subsequently causing ischemia in the fetus via inflammatory and thrombotic reactions.
25043528 Our data suggest for the first time a positive correlation between RAGE expression and poor therapeutic outcome in hepatocellular carcinoma after hepatectomy.
25039001 specific role of both AGE and RAGE in inflammation and perpetuation of kidney damage in diabetes and in CKD without diabetes
25031745 these findings suggest that dysregulations of RECK and RAGE expressions may be collectively involved in tumor progression of nasopharyngeal carcinoma by regulating MMP9 expression
25016700 studied levels of serum sRAGE in asthmatic children. sRAGE showed statistically significant lower levels in asthmatic patients (899.1 +/- 399.8 pg/mL) compared to the control group.
25014735 We will summarize the current knowledge on the role of RAGE in pathologies promoting Alzheimer's disease and in Alzheimer's disease progression--{REVIEW}
25012910 Data suggest that serum RAGE/AGER can be useful as biomarker for metabolic syndrome: lower level of soluble RAGE/AGER is associated with a number of components of metabolic syndrome (central obesity, hypertension, and hyperglycemia).
25002577 findings indicate that the functional interaction between RAGE and DAP10 coordinately regulates S100A8/A9-mediated survival and/or apoptotic response of keratinocytes
24984291 AGE-mediated exacerbation of RAGE expression may contribute to oxidative stress generation that plays a key role in pathogenesis of vascular complications in diabetes.
24982031 S100A13 interacts with the C2 domain of RAGE.
24978055 tracheal instillation of AGEs promoted clearance of lung fluid, whereas concomitant inhibition of RAGE, PKC, and gp91(phox) abrogated the response
24971542 Thus, autophagy may function as a negative counter-regulatory mechanism for HMGB1-DNA complex-induced inflammasome activation, and provide a checkpoint to limit the development of inflammation.
24952599 interaction of S100A4-RAGE mediates S100A4-induced colorectal cancer cell motility
24934531 Review of the role played by RAGE (receptor for advanced glycation end products) and CD163 belonging to pattern recognition receptors in the early immune response of lungs.
24887223 No evidence was found that HMGB1 and sRAGE contribute to the development of TRALI.
24870978 The role of RAGE in nanotube formation and function, was examined.
24839222 This study demonstrated that circulating esRAGE levels are independently associated with smaller cIMT in T2DM patients.
24824951 Binding of methoxylglyoxal-modified albumin to RAGE results in signal transduction.
24776932 impact of serum high mobility group box 1 and soluble receptor for advanced glycation end-products on subclinical atherosclerosis in patients with granulomatosis with polyangiitis
24744309 Data suggest that circulating levels of soluble RAGE are not influenced by dietary proteins that are either high or low in advanced glycation end products (produced by cooking food with either high or low temperatures).
24742661 Age and AGER polymorphisms are associated with the circulating sRAGE concentration among children with type 1 diabetes
24740401 sRAGE is a novel biomarker that inversely associated with diverticulosis.
24727234 Pioglitazone suppresses RAGE expression and increases circulating sRAGE/esRAGE, and those activities are not necessarily dependent on plasma glucose or insulin resistance levels.
24705787 RAGE and HMGB1 are involved in the (patho-)physiology of thymus, as evidenced by differentiated thymic and systemic expression patterns that may act as diagnostic or therapeutic targets in autoimmune disease and cancer.
24697697 RAGE isoform expression and subcellular localization could be important determinants for the regulation of its function in tumor progression.
24656601 This study demonistrated that lower levels of sRAGE is independently associated with presence and number of cerebral microbleeds in patients with first-ever acute lacunar stroke, particularly in those with deep cerebral microbleeds.
24625976 Ribose accelerated AGE formation in U251 and U87MG astrocytoma cells, inducing upregulation of receptor for AGEs.
24619131 Although there was no suggestive evidence for the presence of epistasis in RAGE gene, the rs184003 SNP might play a predominant role in the development of breast cancer.
24613454 RAGE overexpression is associated with the up-regulation of the RAGE ligand.
24605038 Genetic defects in the RAGE gene are strongly associated with Crohn's disease in Chinese Han population.
24603633 deregulated HMGB1/RAGE axis found in our study may present an early pathogenic event in multiple sclerosis
24564838 Plasma esRAGE is decreased in chronic obstructive pulmonary disease patients compared to controls, but only sRAGE has a significant and independent association with disease state.
24554430 RAGE upregulates myogenin which upregulates MyoD and downregulates PAX7, with consequent inhibition of proliferation and stimulation of differentiation.
24535058 Suggest overexpression of RAGE contributes to cigarette smoke-induced NO generation in COPD with involvement in NF-kappaB activation.
24526523 These data indicate that the RAGE plays an important role in the development of Spinal cord injury and might provide a therapeutic target to promote recovery from Spinal cord injury.
24520905 Preliminary evidence that the G82S polymorphism in the RAGE gene is associated with an increased risk of COPD in the Chinese population.
24515114 RAGE gene could be an effective target for ADPKD treatment
24510323 HMGB1-RAGE axis may become a potential target in HCC therapy
24486339 siRNA against P2Y2R or RAGE, suggesting that P2Y2R is an important mediator in oxLDL-mediated monocyte adhesion to ECs through the regulation of ROS-dependent adhesion molecule expression in ECs.
24484607 It is a key player in neuronal differentiation.
24472555 Data indicate that high glucose-induced barrier leakage was mediated largely by activation of the receptor for advanced glycation end products (RAGE).
24441189 upregulation of RAGE expression is associated with lymph node metastases of gastric cancer, and blockade of RAGE signaling suppresses growth and invasion of gastric cancer cells through AKT pathway
24427342 Increased AGE-RAGE interaction may play an important role in the pathogenesis of idiopathic pulmonary fibrosis
24420130 It is a pattern-recognition receptor for HMGB1 and various lignds. (review)
24418399 RAGE gene polymorphism is associated with vascular complications in Indian type 2 diabetes mellitus.
24397807 High AGE/esRAGE ratio, found in diabetic patients with hyperlipidemia, pointed to increased production of AGEs and low expression of esRAGE.
24395344 RAGE pathway is activated in the pathophysiology of dermal inflammation and skin denervation in vasculitic neuropathy and diabetic neuropathy
24373844 Showed that during recombinant human sRAGE expressing in CHO Cells, use of GeneOptimizer software program-assisted, reengineered sRAGE cDNA enhances the recombinant protein expression in CHO cells.
24363518 RAGE is up-regulated in Crohn's disease, especially in inflamed areas, and it appears to play a role in the mechanisms involved in chronic inflammation.
24329736 sRAGE may play a role in the pathogenic processes that link albuminuria, chronic inflammation and oxidative stress in hypertensive patients.
24304868 RAGE -429T/C polymorphism is associated with susceptibility to Parkinson's disease in a Chinese Han population.
24303922 Expression levels are significantly higher in melanomas than in nevus pigmentosus
24303504 The G82S polymorphism in the RAGE gene is associated with diabetic retinopathy risk, and G82S was associated with circulating levels of circulating RAGE.
24302816 HMGB1 acts in synergy with LPS to upregulate TLR4 and RAGE expression on the surface of SF in rheumatoid arthritis and then to augment IL-6, MMP-3, and MMP-13 production, which depends on p38 MAPK and NF-kappaB activation
24284407 there was a prevalence of AA genotype and A allele of the RAGE gene in long-living subjects and a prevalence of the allele T in middle-aged subjects
24276462 The higher the follicular fluid sRAGE, the lower the number of international units of gonadotropin needed per cycle independent of age, BMI, or day 3 FSH level. The data support a relationship between follicular fluid sRAGE and measures of ovarian reserve
24276448 A high circulating esRAGE level, but not sRAGE level, was associated with a low metabolic syndrome incidence among Japanese adult men.
24260107 these data indicate that RAGEDeltaICD represents a novel endogenous mechanism to regulate RAGE signaling.
24252909 These results suggested that AGEs may promote JNK activation, leading to viability inhibition of ECV304 cells via the RAGE signaling pathway.
24248547 the RAGE gene Gly82Ser polymorphism may confer not only an increased risk of colorectal cancers (CRC) but also an increased invasion of CRC in the Chinese population.
24231387 Chronic overstimulation of the AGE receptor (RAGE) pathway is a major contributor in patients with chronic kidney disease.
24228859 In Streptozocin-induced diabetes, deficient hyperglycemia caused the pathophysiology of Alzheimer's disease in transgenic mice by modulating AGEs/RAGE/NF-kappaB pathway.
24228009 Coronary artery disease (CAD) patients presenting with peripheral artery disease have lower sRAGE levels than CAD patients without peripheral atherosclerosis, showing that stable lesions in different vascular districts are inversely related to sRAGE.
24217195 Plasma advanced glycation end products (AGEs), receptors for AGEs and their correlation with inflammatory markers in middle school-age children.
24188108 In AKI patients, PAPP-A, EN-RAGE and HMGB1 are elevated, but sRAGE and PlGF are not increased.
24177755 RAGE-binding S100A8/A9 promotes the migration and invasion of human breast cancer cells through actin polymerization and epithelial-mesenchymal transition.
24156267 This study demonistrated that the Receptor for Advanced Glycation End products statistically significant deviations between AD patients and healthy controls concerning RAGE -374 SNP genotype.
24155913 The interactive association of RAGE gene four common polymorphisms with the risk of developing coronary artery disease in a large northeastern Han Chinese population, is reported.
24133579 RAGE is expressed by acinar and interstitial cells in the pancreas. During acute pancreatitis infiltrating inflammatory cells also express RAGE. Hyperglycemia, which aggravates pancreatitis, reduces the production of two RAGE proteins in the pancreas.
24113348 These observations suggest that RAGE promotes premature senescence of proximal tubular epithelial cells by activation of endoplasmic reticulum stress-dependent p21 signaling.
24107402 results showed a close correlation between the 82G/S polymorphism and the susceptibility to IS, suggesting the 82G/S polymorphism may be used as a genetic marker for the prediction of stroke occurrence in high risk subjects.
24081950 The receptor for advanced glycation end-products (RAGE) promoted DNA uptake into endosomes.
24078092 possession of the -374A allele may be a risk factor in CAD among Caucasian patients with type two diabetes.
24058542 Elevated values of soluble RAGE are associated with worse in-hospital prognosis, whereas high fluorescent advanced glycation end products levels are associated with more follow-up events.
23975852 Galectin-3 and RAGE modulate in divergent ways, not only inflammation, but also vascular osteogenesis, via Wnt/beta-catenin signalling.
23973487 ABETA binds to the V domain of receptors for advanced glycation end-products (RAGE). Blocking of RAGE-ABETA interaction inhibited transport of peripheral ABETA into the brain.
23954397 Studies indicate that RAGE and Toll-like receptor (TLR) share several common ligands including HMGB1, the S100A8/A9 heterodimeric protein complex and LPS.
23947473 SNPs associated with systemic sRAGE levels in emphysema
23911608 HMGB1 promotes an inflammatory response by inducing the expression of ICAM-1 and P-selectin via advanced glycosylation end product-specific receptor RAGE - mediated stimulation of the endoplasmic reticulum stress pathway.
23894685 association of AGER genetic polymorphisms with coronary artery disease (CAD) was potentiated in patients with diabetes mellitus or renal disease; circulating esRAGE might be a powerful negative predictor for the development of CAD (Meta-Analysis)
23874853 Potential interactive contribution of RAGE and APE1 genes to the pathogenesis of lung cancer.
23867237 This study suppoert early age of drinking onset upregulates RAGE/TLR4-HMGB1 and other neuroimmune genes that persist into young adulthood and could contribute to risk of alcoholism or other brain diseases associated with neuroinflammation.
23861159 Alogliptin treatment improved the AGE-RAGE axis and reduced albuminuria in Japanese type 2 diabetes patients.
23855502 Tight junctions are identified as the basic structure of the blood-brain barrier and RAGE-mediated Abeta cytotoxicity to the brain microvascular endothelial cells, resulting in damaged BBB structural integrity
23759926 (epsilon)-Carboxymethyllysine stimulates serotonin release and activates RAGE.
23755764 The expression of RAGE is decreased in gastric adenocarcinoma and metastatic lymph node tissues, and is associated with the N stage.
23729200 courses of circulating nucleosomes and immunogenic cell death markers HMGB1 and sRAGE show prognostic relevance in PC patients undergoing chemotherapy
23721855 RAGE gene polymorphism has a significant effect on AGEs level and PON1 activity in diabetic subjects compared to healthy individuals.
23712703 Data indicate that HMGB1-induced the release of inflammation cytokines including TNF-alpha, IL-8, IL-10, and MCP-1 in bronchial epithelial cells through activating RAGE/JNK/NF-kappaB p65 pathway.
23693020 The expression of miR-155 is regulated by S100P and is dependent on RAGE activation and stimulation of AP-1.
23628898 immune complexes elicit proinflammatory responses in endothelial cells and alter their function involving cellular signaling via the HMGB1-RAGE axis in the pathogenesis of systemic lupus erythematosus vasculitis
23593165 -374 T/A RAGE polymorphism could be associated with CKD progression and inflammation. No relationship was found between circulating RAGE and renal function decline.
23579957 RAGE expression levels are correlated to the degree of severity of breast cancer. RAGE siRNA arrested cells in the G1 phase and inhibited DNA synthesis (p < 0.05).
23571222 The 82G>S polymorphism of RAGE gene may be associated with the susceptibility of epithelial ovarian carcinoma.
23559480 RAGE appeared to interact directly with the F protein, but, rather than inhibiting respiratory syncytial virus entry into host cells, virus replication and budding, membrane-expressed RAGE or soluble RAGE blocked F-protein-mediated syncytium formation and sloughing.
23552832 This study suggests that sRAGE/pentosidine ratio could serve as a risk factor determinant for type 2 DR as it has a positive correlation with the severity of DR.
23545311 But lower level of sRAGE when compared to DR patients with wild-type 2245GG.
23527722 The RAGE -374 T/A polymorphism is related to the genesis of atherosclerotic coronary artery disease but not to its evolution, and the protective role of the AA genotype in respect to atheromatous disease is therefore confirmed.
23525442 Advanced glycation end-products receptor is associated with pulmonary arterial hypertension development.
23523633 The activation of RAGE in the hippocampus contributes to seizures and to the proictogenic effects of HMGB1
23508966 Data suggests that RAGE is involved in apoptosis of renal tubular cells facilitated via high glucose-induced generation of reactive oxygen species; this mechanism may be involved in pathogenesis of diabetic nephropathy.
23466064 Hence, we hypothesized that RAGE inducing cancer stem cells may be a key determinant in the origin and progression of colon malignant tumors concomitant diabetes.
23432638 Data suggest that Chinese patients with type 1 diabetes have higher serum soluble form of RAGE and endogenous secretory form of RAGE than control subjects; insulin stimulates shedding of soluble form of RAGE from plasma membrane of macrophages.
23426492 The influence of immunosuppressive drugs on S100A8/A9-RAGE mRNA expression may suggest a role of these proteins in early-stage SCC development in immunosuppressed patients
23421467 this study revealed that RAGE exacerbated the malignant phenotype of human fibrosarcoma cells
23398829 Soluble RAGE expression is increased in subjects with Takayasu's arteritis.
23340902 expression of RAGE and its ligand (S100A9) in cervical lesions
23331756 Elevated plasma receptor for advanced glycation end products is associated with bronchiolitis obliterans syndrome.
23325627 sRAGE inversely associated with liver cancer
23318458 RAGE and HMGB1 coordinately enhanced tumor cell mitochondrial complex I activity, ATP production, tumor cell proliferation and migration.
23288172 Early poststroke plasma sRAGE may play a protective role in ischemic stroke by capturing HMGB1.
23284645 RAGE intermolecular disulfide bond
23275625 RAGE is inducibly expressed on lung endothelium, and one functional consequence of RBC transfusion is increased RAGE expression and endothelial activation.
23254359 DOCK7 binds to the RAGE cytoplasmic domain and transduces a signal to Cdc42.
23252485 In patients with ischemic stroke, genetic variation in RAGE is associated with ischemic stroke subtype small-vessel disease, but not overall ischemic stroke.
23236395 This meta-analysis demonstrates that there is no association between the RAGE -429T/C, -374T/A and G82S polymorphisms and coronary heart disease.
23228658 The results support the possibility that plasma levels of sLRP and sRAGE may help with the diagnosis of Alzheimer's disease
23218576 Circulating levels of RAGE were independently associated with asymmetrical dimethylarginine levels.
23206470 An independent, significant and inverse correlation exists between circulating levels of sRAGE and oxidized LDL.
23182709 RAGE polymorphisms are related to a large number of immunity-asociated diseases. (Review)
23171632 Data indicate that resistin, S100A12 and soluble receptor for advanced glycation end products (sRAGE) are involved in the pathophysiology of Kawasaki disease (KD).
23144152 Results suggest that the RAGE 82G>S polymorphisms, interacting with HPV infection, are implicated in the occurrence of cervical cancer.
23103427 RAGE activation may not be restricted to pathological statuses, the receptor being involved in tissue homeostasis and regeneration/repair upon acute injury, and in resolution of inflammation.
23091285 Data suggest that serum levels of soluble RAGE, advanced glycation end products, and pentosidine are up-regulated in patients with microvascular complications (including diabetic retinopathy and diabetic nephropathy) in type 2 diabetes.
23071492 association between genetic polymorphisms of RAGE and susceptibility, chemotherapy response rate and prognosis of non-small cell lung cancer (NSCLC); the 82SS genotype and 82S allele distribution not only increased the NSCLC risk, but also was associated with a lower chemotherapy response rate and poor prognosis
22989605 Increased levels of serum RAGE are associated with atrial fibrillation.
22987041 These results showed that only the 82G/S RAGE polymorphism had a closely association with osteoarthritis risk by multiple regression analyses.
22983919 This is the first study showing the relevance of the immunogenic cell death biomarkers HMGB1 and sRAGE for prediction of response to neoadjuvant chemotherapy in confined breast cancer patients.
22966766 Carriers of the A allele of -374 T/A RAGE show an independent risk of atherosclerosis and reduced renal function in male hypertensive patients with diabetes mellitus.
22965881 High sRAGE expression is associated with treatment response in liver cancer.
22964273 Data indicate that the -374T>A and -429T>C polymorphisms in the receptor for advanced glycation end-products (RAGE) gene were not associated with the susceptibility and prognosis of heart failure (HF).
22960399 HMGB1 and RAGE levels in induced sputum correlate with asthma severity and neutrophil percentage.
22920235 Increase in soluble RAGE level was associated with a decrease in Aortic augmentation index, suggesting that sRAGE may play an important role in the ligand-soluble RAGE interaction propagated inflammation and vascular stiffness in rheumatoid arthritis.
22900949 In the early stages of pregnancy, lower circulating sRAGE levels, and the ratio of sRAGE to AGEs, may be associated with the subsequent development of pre-eclampsia in women with Type 1 diabetes mellitus.
22863784 LOX-1 up-regulation induced by AGE-BSA was a receptor mediated through RAGE and is via the PI3K/PDK1/mTORC2 pathway
22860029 The functional promoter AGER -429C variant is associated with an increased RAGE expression that can lead to an increased lung inflammation and a more severe lung disease in cystic fibrosis.
22860017 Metalloproteinase-mediated shedding of the type I membrane protein RAGE is inducible by activation of G protein-coupled receptors linked to different signal transduction pathways.
22843047 A high degree of RAGEv1 expression significantly reduced the expression of normalized mRNA transcripts of NF-kappaB and TNF-alpha in HepG2 cells.
22837190 Aerobic exercise increases sRAGE levels along with improvement of various cardiometabolic risk factors in patients with type 2 diabetes.
22835520 analysis of elevated serum levels of AGEs, sRAGE, and pentosidine in Tunisian patients with severity of diabetic retinopathy
22827914 The RAGE rs1800625 polymorphism was significantly associated with sepsis morbidity rate and multiple organ dysfunction (MOD) scores in Chinese patients with major trauma.
22785051 Circulating sRAGE levels are associated in an inverse manner with non-calcified plaque burden, suggesting that it may be related with early atherosclerosis and plaque progression.
22777515 This review summarizes the characteristics of RAGE, RAGE isoforms, RAGE ligands, and signaling pathways in the pathogenesis of ALI and ARDS.[review]
22771726 No evidence of an association of RAGE or glyoxalase I single nucleotide polymorphisms with pathological pregnancy.
22754344 Results show that RAGE is overexpressed in primary hepatocellular carcinoma (HCC) and regulates cellular proliferation of HCC cells.
22652038 Serum levels of advenced glycation end producsts and RAGE receptors were inversely related to adiponectin levels in vasculitis.
22633675 Serum RAGE receptor level was significantly increased in paroxysmal and persistent atrial fibrillation patients.
22616947 Elevated plasma sRAGE levels correlated with impaired lung function following cardiac surgery in children.
22578261 An alarmin, HMGB1, and one of its receptors, sRAGE, are engaged in the process of clinical chorioamnionitis at term.
22553402 results suggest that Glycer-AGEs-RAGE signaling enhances the angiogenic potential of hepatocellular carcinoma cells by upregulating VEGF expression.
22513366 RAGE polymorphisms are associated with susceptibility to systemic lupus erythematosus (SLE) and lupus nephritis (LN).
22509345 Our studies have identified the expression of RAGE on adaptive immune cells and a role for this receptor and its ligands in modulating human immune responses.
22509024 critical role for RAGE expression in the earliest stages of pancreatic carcinogenesis, potentially acting as the "autophagic switch," regulating mitochondrial STAT3 signaling
22490537 AGE-RAGE effect is a critical mediator for oxidative stress in diabetic wound tissue during wound healing.
22475522 The association of RAGE gene polymorphisms (Gly82Ser, 1704 G/T, 429 T/C) with type 2 diabetes mellitus (T2DM), diabetic retinopathy (DR) and diabetic nephropathy (DN) risk, respectively was assessed. And no significant association was found of the three polymorphisms with T2DM, DR and DN risk. [Meta-analysis]
22460069 RAGE protein is highly expressed in human upper airways under normal physiology and that it is subject to differential processing in CRSsNP and CRSwNP, identifying S aureus and ECP as novel and crucial players in this process.
22427038 RAGE gene Gly82Ser, 1704G/T and 2184A/G polymorphisms are not associated with retinopathy development in the Malaysian population.
22417726 TNF-alpha, TNFRII and Cx43 are downstream effectors of the AGEs-RAGE interaction in human microglial cell culture.
22405771 these data suggest a role for the RAGE pathway in the pathophysiology of myasthenia gravis.
22402134 results provide convincing evidence regarding the association of RAGE gene 1704T allele with an increased risk of diabetes mellitus, especially diabetic retinopathy; this effect was more pronounced in East Asians [meta-analysis]
22386596 data link C1q and RAGE to the recruitment of leukocytes and phagocytosis of C1q-coated material
22382005 these data suggest that patterns of serum RAGE ligand concentration indicate different inflammatory pathways in normal pregnancy, early onset and late onse preeclampsia.
22366088 RAGE expression and its downstream signaling proteins NADPH oxidase and NF-kB in HER2/neu negative invasive ductal carcinoma were studied.
22354095 A meta-analysis confirmed an association between the RAGE -374T/A polymorphism and retinopathy in subjects with type 2 diabetes and the -374AA allele was found to be a protective factor for type 2 diabetes.
22353366 Age might modulate the genetic effects of variation of rs204994 in AGER gene on the susceptibility to hypertension but not blood pressure trait in Han Chinese population
22339587 Patients with higher levels of sRAGE - who therefore may have an enhanced capability to regulate their immune response - appear less likely to experience preterm birth and neonatal sepsis.
22337892 Increased plasma levels of sRAGE in type 1 diabetes may provide protection against cell damage and may be sufficient to eliminate excessive circulating malondialdehyde during early years after disease onset.
22315985 Receptors for advanced glycation end products system seems to be related to the development of atherosclerosis even in obese prepubertal children.
22264245 The association of elevated sRAGE with a fatal outcome suggests that it may have an independent causal effect in community-acquired pneumonia.
22229442 Advanced glycation end products may play an important role in the impairment of diabetic wound healing by upregulating MMP-9 expression in keratinocytes via the RAGE, ERK1/2 and p38 MAPK pathways, and activation of NF-kappaB.
22212601 In hypertensives, decreased sRAGE levels are accompanied by pronounced albuminuria and arterial stiffening.
22211895 levels of soluble RAGEs and polymorphisms in the gene encoding RAGE may hold promise for the identification of patients who are vulnerable to the complications of diabetes (review)
22206663 The results of this study showed that down regulation of RAGE expression by RNAi inhibited the cell proliferation of androgen-dependent (LNCaP) and androgen-independent (DU-145) prostate cancer cells.
22194616 a novel mechanism through which an extracellular signal initiated by RAGE ligands regulates RAGE signaling in a manner requiring mDia1.
22189627 psoriasin expression in mammary epithelial cells leads to increased endothelial cell proliferation in a paracrine manner through the receptor for advanced glycation end products.
22154374 -429T/C and -374T/A polymorphisms in the promoter region of RAGE gene were not associated with Malaysian type 2 diabetic retinopathy patients
22146151 carriers of Gly82Ser polymorphism in RAGE were found to have significantly higher scores for the psychoticism personality trait comprising the detachment and suspicion subscales
22137663 Circulating sRAGE showed significant association with target-to-background ration values measured using FDG-PET, which reflect vascular inflammation.
22116960 This is the first study that shows an association between the 2245A allele of the RAGE gene and development of diabetic retinopathy in the Malaysian population.
22114731 RAGE polymorphism is associated with aspergillosis in stem cell transplant recipients.
22097731 Valsartan could inhibit RAGE expression through downregulation of oxidative stress in human glomerular mesangial cells.
22072229 Plasma RAGE levels are elevated in patients with acute coronary syndrome with positive cTnI, suggesting that they could be related to myocardial cell damage.
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
22025532 The expression of eosinophil RAGE, soluble RAGE and RAGE ligands may be pivotal to the functions of eosinophils in various human diseases involving RAGE and S100 ligands.
22012330 Wild-type RAGE+/+ neutrophils demonstrate significantly greater ability to kill Escherichia coli in peritoneal fluid compared with RAGE-deficient neutrophils from transgenic RAGE knockout mice, both in vitro and in vivo.
21990362 the functional receptor for HMGB1 consists of a complex of RAGE and cell surface heparan sulfate.
21978883 NADPH oxidase complex assembly and reactive oxygen species production are not required for Abeta binding to RAGE at astrocytic surface
21965014 AGER polymorphism was not found to be associated with COPD risk
21947881 The presence of Gly allele in rage gene contributes to the coronary artery disease in non-diabetics and Ser allele may contribute to disease in diabetics.
21947243 RAGE knockdown partially reversed the promoted effect of cell proliferation, migration and invasion induced by HMGB1.
21945853 Data suggest that silence of RAGE expression could effectively inhibit colorectal cancer angiogenesis in vitro and in vivo.
21941211 Soluble forms of the receptor for advanced glycation end product could be an endogenous protection factor against occurrence of diabetic foot.
21920897 Subjects with neutrophilic asthma or COPD had undetectable levels of lung advanced glycation end-product receptor, while levels of soluble advanced glycation end-product receptor in asthma/COPD without neutrophilia were similar to those in controls.
21914366 Both HMGB1 and RAGE participate in the inflammatory process of asthmatic airway.
21906738 Suggest that elevated plasma EN-RAGE and decreased sRAGE level could play a crucial role in systemic inflammation and carotid atherosclerosis in peritoneal dialysis patients.
21872861 Suggest that sRAGE may have a protective effect against subclinical atherosclerosis by preventing inflammatory responses in HIV-infected patients receiving combined antiretroviral therapy.
21871056 Investigated if expression of the receptor for advanced glycation end-products release affects insulin therapy in critically ill hyperglycemic diabetic versus non-diabetic patients. Findings support the hypothesis.
21865159 the assembly of the RAGE homodimer, which is essential for signal transduction, and the sRAGE:RAGE heterodimer that leads to blockage of the receptor signaling.
21861709 The A allele of RAGE -374T/A polymorphism in diabetic CAD patients and the-374T/Ala12 haplotype of RAGE -374T/A and PPAR-gamma Pro12 Ala polymorphisms in the patients group are the most important risk factors for CAD.
21844192 RAGE has a role in endothelial cell membrane repair and regulates F-actin remodeling and membrane resealing
21829704 Blocking of the function of TIRAP and MyD88 largely abrogated intracellular signaling from ligand-activated RAGE
21771973 Higher levels of sRAGE and esRAGE are associated with incident coronary heart disease but not stroke in type 2 diabetes.
21767223 Serum esRAGE concentrations and esRAGE/sRAGE ratio in patients with preeclampsia significantly increased compared to controls.
21749686 RAGE was overexpressed in rheumatoid arthritis and RAGE production was stimulated by IL-17 and IL-1beta.
21736957 In patients undergoing major vascular abdominal surgery, RAGE values increase at first mechanical ventilation stage but not thereafter, compared to surfactant protein-B(SPB) kinetics.
21724696 Levels of serum RAGE are reduced in patients with juvenile rheumatoid arthritis and correlate negatively with disease activity and S100A12 levels. Serum RAGE may be a modulator of inflammation in these patients.
21680901 RAGE activation accounts for many features of Vascular remodeling diseases including VSMC proliferation and resistance to apoptosis by the activation of STAT3/Pim1/NFAT axis.
21617715 Cell migration assay showed that the interaction between RAGE and HMGB-1 increased SCC7 migration activity depending on the level of HMGB-1. Nifedipine inhibited the interaction effect between RAGE and HMGB-1 on SCC7 cells in a dose-dependent manner.
21609778 The authors reported a new role of the receptor for advanced glycation end-products (RAGE) on the adherence of Helicobacter pylori to gastric epithelial cells, assessed by different methods and binding to immobilized RAGE.
21576827 Soluble receptor of advanced glycated endproducts is associated with plaque vulnerability in patients with acute myocardial infarction.
21565706 The solution structure of a Nepsilon-carboxy-ethyl-lysine (CEL)-containing peptide-RAGE V domain complex reveals that the carboxyethyl moiety fits inside a positively charged cavity of the V domain.
21540233 sRAGE is inversely associated with pancreatic cancer risk among Finnish male smokers
21527578 This is the first epidemiologic study to implicate the receptor for Advanced glycation end products in colorectal cancer development.
21521347 AGER 82S allele showed a protective effect on CAD severity in the presence of T2DM in Chinese Han population.
21512281 activation of RAGE not only inhibits myocardin-dependent SMC gene expression, but also induces osteogenic differentiation of vascular SMC through Notch/Msx2 induction
21511948 the G82S polymorphism promotes N-linked glycosylation of Asn(81), which has implications for the structure of the ligand binding region of RAGE and the enhanced function of the variant
21511691 the gain-of-function p.82G>S polymorphism in the RAGE gene is associated with an increased risk of multiple sclerosis in the Chinese population.
21472688 A differential association between the expression of CNR1/CNR2 and RAGE with morphological changes and expression of molecular markers of inflammation could be established in patients with inflammatory bowel disease
21472666 The cytokine-induced potentiated S100A8 and S100A9 expression under conditions with a high AGE burden is able to aggravate proinflammatory conditions via activation of the RAGE pathway.
21450369 RAGE isoforms can stimulate beta-amyloid production when elevated in Alzheimer brains.
21450080 Emphysema and chronic cor pulmonale are independent predictors of reduced sRAGE in chronic obstructive pulmonary disease.
21432860 Azelnidipine (calcium channel blocker) may exert renoprotective properties in nondiabetic hypertensive chronic kidney disease patients via its unique inhibitory effects on the AGE-RAGE axis.
21389696 Elevated plasma esRAGE is independently associated with CKD and is an independent predictor of incident CKD in older community-dwelling adults
21365018 The HMGB1/RAGE/OPN/Egr-1 pathway may be involved in inflammatory, angiogenic and fibrotic responses in proliferative vitreoretinal disorders.
21357189 The plasma level of endogenous secretory receptor for advanced glycation end products is correlated with higher plasma IL-6 and lower plasma IL-1RA.
21325454 Elevated maternal serum and amniotic fluid RAGE, paralleled by increased RAGE expression in the amniochorion, suggest activation of this system in severe preeclampsia
21317562 RAGE regulates autophagy and apoptosis following oxidative injury
21316677 Compared to whites, Hispanics and blacks have significantly lower sRAGE levels, and these levels were associated with more subclinical brain disease.
21311028 RAGE polymorphism leading to facilitated RAGE gene transcription may to some degree protect from developing a stricturing subphenotype of Crohn's disease
21303685 Our findings show increased expression of TLR2, TLR4, RAGE and HMGB1 in reactive glia in human ALS spinal cord
21298413 Data suggest that inherited AGER gene polymorphisms may confer susceptibility to environmental insults in type 1 diabetes.
21297263 Thia study have identi fi ed a potential associa-tion of sequence variation in the vicinity of AGER on chromosome 6p with dementia and Alzheimers Disease.
21282351 RAGE mRNA and protein expression in SAT from patients with CAD was lower than in patients without CAD.
21278261 Dysregulation of the ezrin/radixin/moesin-RAGE complex might be an important step in rearrangement of the actin cytoskeleton during proinflammatory cytokine-induced epithelial-mesenchymal transition of human alveolar epithelial cells.
21257730 These results support the conclusion that release of RAGE is primarily mediated by proteolytic damage in alveolar epithelial cells in the lung.
21254849 The data suggest that the AGER gene -374T)A polymorphism is not associated with the severity of CAD in non-diabetic Han Chinese individuals.
21254649 The expressions of RECK and RAGE in nasopharyngeal carcinoma were down-regulated.
21211520 Results suggest active involvement of HMGB1-RAGE axis in poor prognosis of acute respiratory distress syndrome.
21208063 The objective of this study was to identify the possible relationship between the -374 T/A polymorphism of the RAGE gene, myocardial infarction (MI), and its age of onset.
21197704 Plasma level of sRAGE may be positively associated with in-stent restenosis
21137019 different RAGE isoforms in idiopathic pulmonary fibrosis and chronic obstructive pulmonary disease
21127710 Toll-like receptors and RAGE expression and their ligands, signaling, and functional activation are increased in preterm birth and may contribute to the proinflammatory state [review]
21126167 Results suggest that RAGE is an important regulator of oxidative injury.
21115116 Pigment eppitheliuim derived factor (PEDF) plays a protective role against tubular injury in diabetic nephropathy by attenuating the deleterious effects of advanced glycation end products (AGEs) via down-regulation of RAGE expression.
21089112 Both low serum sRAGE levels and high AGE/sRAGE ratio have predictive value for post-percutansous coronary intervention restenosis.
21086782 Negative correlation of serum RAGE with the yield of follicles and oocytes in women who conceive after the IVF, may be explained by the essential outflow of RAGE to the follicular compartment.
21080832 increased advanced glycation end-product and RAGE immunostaining in the hippocampi of multiple sclerosis patients, similar to Alzheimer's disease patients
21072897 Results describe the proliferative effect of advanced glycation end-products and the role of their cellular receptor on hepatocellular carcinoma cells, and the inhibitory effects of MK615.
21067489 The present data show a difference in the association of variations in ALR2, iNOS and TNFB genes with diabgetic retinopathy, when compared to our previous reports.
20947022 Results enhance understanding of the functional outcomes of S100 protein binding to RAGE and provide insight into mechanistic models for how the receptor is activated.
20943659 The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
20928981 RAGE interacts with endogenous ligands, resulting in chronic inflammation. It is implicated in multiple human illnesses, including diabetes, arthritis, Alzheimer's disease, atherosclerosis & aging-associated diseases. Review.
20847094 Circulating S100A12 and soluble RAGE are both elevated in hemodialysis patients. However, only S100A12 associates with mortality, partly explained by its links with inflammation.
20739563 Microglial RAGE signaling plays a prominent role in Abeta-induced entorhinal cortex synaptic dysfunction.
20732329 The highlight of the present study is the contrasting behavior of the different regions of the protein, with the protected regions neighboring fully exposed parts especially in the N-terminal V domain.
20726326 the possible role of sRAGE as a marker of early nephropathy in diabetic patients.
20701913 the AGE-RAGE axis has a role in the amplification of pro-atherogenic responses triggered by P. gingivalis in vascular endothelial cells
20685137 sRAGE is an endogenous protection factor against the occurrence of accelerated diabetic retinopathy
20684319 Prostate cancer tissue exhibited a significantly higher expression of RAGE than normal prostate tissue.
20668462 Association of polymorphisms in the RAGE gene with serum CRP levels and coronary artery disease in the Chinese Han population is reported
20650982 Surfactant protein B and RAGE increases in the plasma during cardiopulmonary bypass
20631986 Evidence supporting a role of the RAGE axis in the pathogenesis of systemic inflammation, ALI and myocardial dysfunction is compelling with numerous animal experiments showing the beneficial effects of inhibiting the RAGE axis
20630999 Results suggest that RAGE, NOX, and H-Ras/Raf-1 are implicated in the up-regulation of HSF1 or PAI-1 in vascular EC under diabetes-associated metabolic stress.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627100 sRAGE levels were significantly lower in knee osteoarthritis patients compared with controls, and sRAGE levels in plasma and synovial fluid also decreased significantly as the disease severity increased
20595148 analysis of Reduced soluble receptor for advanced glycation end-products in COPD
20578941 The results showed that RAGE and its splice variants increased in esophageal cancers and decreased in lung cancers.
20568058 functional promoter polymorphisms of the RAGE gene were not associated with gestational diabetes or its complications in these Euro-Brazilian patients
20568058 Observational study of gene-disease association. (HuGE Navigator)
20567859 The data speak for a weak, but significant effect of AGER on risk of Alzheimer's disease.
20567859 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20541603 Role of RAGE in thromboxane biosynthesis in rheumatoid arthritis.
20537326 expression increased in endometriotic cells
20522598 High levels are associated with incident fatal and nononfatal cardiovascular disease and all-cause mortality in individuals with type 1 diabetes.
20512925 carboxylated N-glycans on RAGE enhance binding potential and promote receptor clustering and subsequent signaling events following oligomeric S100A12 binding.
20507991 a novel mechanism by which an extracellular signal initiated by RAGE ligand AGEs regulates Egr-1 in a manner requiring mDia-1
20504772 Dimerization of RAGE represents an important component of RAGE-mediated cell signaling.
20492604 AGE-RAGE interactions may be one mechanism by which transfused red blood cellss cause endothelial cell damage
20485444 Observational study of gene-disease association. (HuGE Navigator)
20414834 [REVIEW] the interaction of HMGB1 and RAGE is a key component initiating and sustaining the inflammatory response in inflammatory cardiomyopathy eventually leading to heart failure
20410680 conclusion: the -374A allele of the RAGE gene might be a protective factor for vascular complications in type 2 diabetes mellitus especially in Caucasians and macrovascular disease [Meta-Analysis]
20398646 The soluble RAGE is decreased in patients with pancreas cancer compared to patients with type 2 diabetes mellitus and controls.
20398646 Observational study of gene-disease association. (HuGE Navigator)
20372816 Results indicate that resveratrol prevents the impairment of advanced glycosylation end products on macrophage lipid homeostasis partially by suppressing RAGE via PPARgamma activation.
20359471 The phenotype of minor allele carriers in G82S is associated with reduced levels of protective sRAGE in healthy infants.
20359119 The expression levels of RAGE were significantly higher in laryngeal squamous cell carcinoma than these in laryngeal normal tissues.
20353610 association of nine single nucleotide polymorphisms in ADPRT1, AKR1B1), RAGE, GFPT2 and PAI-1 genes with chronic renal insufficiency among Asian Indians with type 2 diabetes
20215707 AGE/RAGE-related MMP-9 expression and apoptosis were correlated with ACE expression in diabetic plaques and RAS may be involved in AGE-dependent diabetic vascular complications.
20185929 study shows for the first time a link between RAGE and GLO polymorphisms in the prognosis of hemodialysis patients
20171262 These findings suggest that PLC/CAMK IV-NF-kappaB is involved in RAGE mediated signaling pathway in human endothelial cells.
20112183 We conclude that ascertained functional differences in the regulatory regions of the AGER gene might have significant consequences for the development of hyperglycemia-related pathology in diabetics.
20093728 RAGE and S100 protein transcription levels are highly variable in human melanoma tumors and cells
20074734 sRAGE may have a role in calcific aortic valve stenosis
20051912 In unstratified analyses, no consistent associations between RAGE SNPs and prevalent cardiovascular disease and markers of atherosclerosis were found.
20040351 The 63 bp del-/+ genotype of the RAGE gene has a marginal benefit on the cardiovascular event-free survival in subjects with diabetic nephropathy.
20031245 sRAGE maybe act as a novel biomarker for predicting the atherosclerosis in diabetes at the early stage.
20028726 Many RAGE ligands are expressed by cancer cells & many cell types within the tumor microenvironment. Via the RAGE receptor, these ligands interact in autocrine & paracrine manners, promoting cell proliferation, invasion, angiogenesis & metastasis. Review.
20028692 the G-stretches within exon 9B regulate RAGE alternative splicing via interaction with hnRNP H
20023238 Possession of the A allele of the RAGE gene was found to be an independent risk factor in coronary artery disease in patients with diabetes mellitus.
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20010834 Data show expression of TNS1, GSTCD, AGER, HTR4 and THSD4 in lung tissue and indicate potential targets for interventions to alleviate respiratory disease.
20010834 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19998499 Data suggest that RAGE stimulation by AGE does not alter fibrogenic activation of hepatic stellate cells, and that RAGE does not contribute directly to hepatic fibrogenesis.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19945761 Plasma RAGE receptor is not significantly associated with urinary microalbumin excretion in the early stage of diabetic nephropathy but is correlated negatively with glomereular filtration rate.
19944695 These findings suggest that activation of RAGE/RhoA is involved in advanced glycation end products -induced hyperpermeability through gap formation and actin reorganization in diabetes.
19924100 Significant inverse relationships were found for sRAGE to intima-media thickness and plaque number in the patients with chronic kidney disease
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910580 interaction of RAGE and its ligand S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53 signaling.
19909734 The aim of the study was to determine sRAGE levels in physiological pregnancy and their changes in pregnancies complicated by preterm labor or preeclampsia.
19906677 RAGE signaling in microglia contributes to the pathogenesis of an inflammatory response that ultimately impairs neuronal function and directly affects amyloid accumulation.
19902324 the presence of the variant 82S allele could potentially explain the significantly elevated risk of Alzheimer's disease in subjects carrying the variant genotypes
19890027 The mechanism by which Gly82Ser polymorphism alters the RAGE levels remains to be elucidated
19876719 Expression of HMGB1 protein and its receptor RAGE in human malignant tumors.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19834494 Our data suggest that targeted inhibition of RAGE or its ligands may serve as novel targets to enhance current cancer therapies.
19822091 Molecular study of receptor for advanced glycation endproduct gene promoter and identification of specific HLA haplotypes possibly involved in chronic fatigue syndrome.
19820033 Reduction of advenced glycation end products in normal diets may lower oxidant stress/inflammation and restore levels of AGER an antioxidant, in healthy and aging subjects.
19815443 findings show receptor engagement by distinct advanced glycation end-products differentially enhances expression of RAGE isoforms and adhesion of red blood cells from diabetic patients
19786934 Data demonstrate that sRAGE level, but not HMGB1 level, is significantly higher in AP patients who develop organ failure than in AP patients without organ failure who recover.
19766904 G82S and -429 T/C polymorphisms of RAGE were associated with the circulating levels of esRAGE but not with coronary artery disease in Chinese patients with Diabetes Melitus, Type 2.
19679874 may be important mediator of cellular injury in fetuses delivered in the setting of inflammation-induced preterm birth
19672558 Studies indicate that RAGE is subject to ectodomain shedding by ADAM10 and MMP9 and the derived sRAGE can sequester Abeta for systemic clearance and antagonize Abeta binding to cell surface RAGE.
19659809 Observational study of gene-disease association. (HuGE Navigator)
19635564 Blockade of the renin angiotensin system by irbesartan may play a protective role against tubular injury in diabetes by attenuating the deleterious effects of AGEs via down-regulation of RAGE.
19616266 advanced glycosylation end-product receptor may capture and eliminate circulating serum high mobility group box 1 in humans
19591173 Extracellular domain of RAGE down-regulates RAGE expression and inhibits p65 and p52 activation in human-salivary gland-cell-lines.
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576587 Report increased expression of RAGE and EN-RAGE in non-diabetic pre-mature coronary artery disease.
19571577 Advanced glycation end products induce calcification of vascular smooth muscle cells through RAGE/p38 MAPK.
19542745 G82S polymorphism in the RAGE gene is associated with diabetic retinopathy and G-A haplotype containing 1704G and 82S allele might be a genetic marker of diabetic retinopathy in Chinese T2DM patients.
19530996 expression detected in synovial tissue and on the immune cells of rheumatoid arthritis patients; genetic polymorphism is associated with disease
19501570 Proteolysis with thrombin or factor Xa revealed several protease sensitive sites in RAGE.
19451748 The plasma concentration of sRAGE was highest in patients with sepsis (2,210 +/- 252 pg/ml), while the levels of sRAGE correlated inversely with that of HMGB1 in patients with acute pancreatitis.
19448391 High circulating AGEs and RAGE predict cardiovascular disease mortality among older community-dwelling women
19440065 Plasma levels of soluble receptor for advanced glycation end products are associated with endothelial function and predict cardiovascular events in nondiabetic patients.
19439163 This study demonstrated an association of decreased serum endogenous secretory receptor for advanced glycation endproducts (esRAGE) level with coronary plaque progression in patients with diabetes.
19405075 Stimulation with advanced glycation end products up-regulated endothelial RAGE expression in saphenous vein endothelial cells cultured from diabetic patients.
19380826 Amyloid beta protein-induced CC-type chemokine receptor 5 (CCR5) up-regulation in human brain microvascular endothelial cells depends on RAGE.
19380603 AGE-2 and AGE-3 activate monocytes via the receptor for AGE (RAGE), leading to the up-regulation of adhesion molecule expression and cytokine production.
19376511 results suggest a possibility that RAGE-VEGF regulation may be related to reproductive dysfunction in aging women
19332646 the role of recombinant human RAGE in Abeta production was examined in the brain tissue of an AD animal model as well as in cultured cells
19285601 G allele at RAGEG82S may be more associated with inflammatory markers under obese status than nonobese conditions.
19284577 RAGE activity influences co-development of joint and vascular disease in rheumatoid arthritis patients.
19277685 The up-regulation of RAGE in the Alzheimer Disease optic nerves indicates that RAGE may play a role in the pathophysiology of Alzheimer Disease optic neuropathy.
19275767 a novel biological and genetic marker for vascular disease (Review)
19252206 Elevated serum advanced glycation end products and their circulating receptors are associated with anaemia in older community-dwelling women.
19248116 IL-7 stimulates chondrocyte secretion of S100A4 via activation of JAK/STAT signaling, and then S100A4 acts in an autocrine manner to stimulate MMP-13 production via RAGE.
19217891 Plasma levels of sRAGE are significantly reduced in definite and borderline nonalcoholic fatty liver disease.
19217461 No significant correlation between serum levels off RAGE in hypertensive agents.
19204726 Observational study of gene-disease association. (HuGE Navigator)
19201044 treatment of THP-1 cells with 100 microg of CRP/ml/10(6) cells for 24 h, augmented the expression of RAGE and EN-RAGE genes
19183936 sRAGE is associated with greater prevalence of cardiovascular disease in type 1 diabetes, which may be explained by endothelial and renal dysfunction.
19167759 Observational study of gene-disease association. (HuGE Navigator)
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19143681 several differences in the levels of advanced glycation end products, sRAGE, and proinflammatory cytokines between euglycemic and diabetic pregnancies
19133252 No association of RAGE selected gene polymorphisms with 12-months outcome of renal transplants was shown in study.
19129693 Angiotensin II induced RAGE mRNA and protein expression through AT2 receptors.
19103440 Our results provide support for a reduction of S100B levels during reconvalescence from acute paranoid schizophrenia that is regulated by its scavenger RAGE
19088375 Increased soluble RAGE is localized in ectopic endometrial cells of both adenomyosis and ovarian endometriomas; RAGE may contribute to the pathogenesis of endometriosis.
19087540 The increased expression of HMGB1 and RAGE in the placenta may play an important role in the pathogenesis of pre-eclampsia.
19071026 These results indicate that RAGE signaling directly contributes to pathology in cerebral ischemia.
19061941 A set of tumours, healthy tissues and various cancer cell lines were screened for RAGE splicing variants and analysed their structure.
19032093 new insight into AGE-RAGE interaction
19023628 Negative RAGE expression correlates with deeper tumor invasion and venous invasion in patients with esophageal squamous cell carcinoma.
19005067 Thus, HMGB1-RAGE signaling links necrosis with macrophage activation and may provide a target for anti-inflammatory therapy in stroke.
18987644 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18952609 ADAM10 and MMP9 to be involved in RAGE shedding.
18948101 RAGE signaling contributes to neuroinflammation in infantile neuronal ceroid lipofuscinosis.
18926539 Serum endogenous secretory RAGE level is an independent risk factor for the progression of carotid atherosclerosis in type 1 diabetes.
18922799 the interaction of the RAGE cytoplasmic domain with Dia-1 is required to transduce extracellular environmental cues evoked by binding of RAGE ligands to their cell surface receptor, resulting in Rac-1 and Cdc42 activation and cellular migration
18854308 HNRNP K and microRNA-16 have roles in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products
18825489 elevated serum HMGB-1 and sRAGE levels are associated with the disease severity and immunological abnormalities in systemic sclerosis.
18796298 We found no consistent association between prevalent type 2 diabetes mellitus and insulin indices and AGER polymorphisms
18796298 Observational study of gene-disease association. (HuGE Navigator)
18789567 Advanced glycation end products (AGE) and circulating receptor for AGE (RAGE) levels are independently associated with decreased glomerular filtration rate (GFR) and seem to predict decreased GFR.
18777492 likely that circulating soluble RAGE and endogenous secretory RAGE are distinct markers and that circulating esRAGE levels are associated with the status of early-stage atherosclerosis.
18775683 RAGE was markedly and diffusely expressed in blood vessels, neurons, and the choroid plexus in the brains of two patients who died as the result of brain edema that developed during the treatment of severe diabetic ketoacidosis
18701333 association of low soluble isoform of RAGE (sRAGE) with high CML-protein levels in diabetic patients who developed severe diabetic complications supports the hypothesis that sRAGE protects vessels AGE-mediated diabetic microvascular damage
18698218 maternal esRAGE concentrations are significantly increased in patients with preeclampsia during pregnancy
18689872 RAGE, carboxylated glycans and S100A8/A9 play essential roles in tumor-stromal interactions, leading to inflammation-associated colon carcinogenesis.
18667420 Structural basis for pattern recognition by the receptor for advanced glycation end products (RAGE).
18660489 Observational study of gene-disease association. (HuGE Navigator)
18657529 RAGE levels increase in conjunction with the onset of Alzheimer's disease, and continue to increase linearly as a function of pathologic severity
18645306 Mediation of RAGE affects the balance of cellular proliferation and apoptosis
18615900 GFR is a principal determinant of sRAGE concentration and gradual sRAGE increase in subjects with advancing impairment of renal function is paralleled by AGE and its receptor
18615900 Observational study of gene-disease association. (HuGE Navigator)
18606705 study defines RAGE (receptor for advanced glycation end products) as the hS100A7 receptor, whereas hS100A15 functions through a Gi protein-coupled receptor; hS100A7-RAGE binding, signaling, and chemotaxis are zinc-dependent in vitro
18603587 The sheddase ADAM10 was identified as a membrane protease responsible for RAGE cleavage.
18595673 Circulating soluble receptor for advanced glycation end products is inversely associated with body mass index and waist/hip ratio in the general population.
18576917 Advanced oxidation protein products might be new ligands of endothelial RAGE. AOPPs-HSA activates vascular ECs via RAGE-mediated signals.
18575614 association between diabetic complications and LTA, TNF and AGER polymorphisms is complex, with partly different alleles conferring susceptibility in type 1 and type 2 diabetic patients
18575614 Observational study of gene-disease association. (HuGE Navigator)
18550199 Serum AGER levels are associated with the severity of renal dysfunction and duration of diabetes in type 2 diabetic patients/
18519797 RAGE Gly82Ser polymorphism may confer not only an increased risk of gastric cancer but also with invasion of gastric cancer in the Chinese population.
18480271 Distinct regions of RAGE are involved in Abeta-induced cellular and neuronal toxicity with respect to the Abeta aggregation state, suggesing the blockage of particular sites of the receptor as a therapeutic strategy to attenuate neuronal death.
18477569 the peritoneal membrane of the uraemic patients showed an increased submesothelial thickness and a marked induction of RAGE expression and NFkappaB-binding activity
18458846 AGEs induce ROS generation and intensify the proliferation and activation of HSCs, supporting the possibility that antioxidants may represent a promising treatment for prevention of the development of hepatic fibrosis in NASH.
18438937 shedding of RAGE might occur as reactive oxygen species accumulate in brain cells and be part of the process of neurodegeneration
18431028 low expression of endogenous secretory RAGE in the hippocampus would be associated with the development of Alzheimer's disease
18427074 results show significant downregulation of the total RAGE mRNA transcripts in peripheral blood mononuclear cells of patients with probable Alzheimer disease
18421017 results indicate that RAGE serves a protective role in the lung, and that loss of the receptor is related to functional changes of pulmonary cell types, with the consequences of fibrotic disease
18355449 These findings reveal new aspects of RAGE regulation and signaling and also provide a new interaction between RAGE and human pathologies.
18339893 S100A8/A9-promoted cell growth occurs through RAGE signaling and activation of NF-kappaB.
18322992 The SAA-RAGE-stimulated NF-kappaB signaling pathway has an important role in the pathogenesis of rheumatoid arthritis.
18302220 study identified advanced glycation end products as the ligand for RAGE on both invasive and non-invasive prostate cancer cells
18279705 -374T/A RAGE polymorphism is an independent protective factor for cardiac events in nondiabetic patients with coronary artery disease
18279703 RAGE could also behave as a receptor for Mycobacterium tuberculosis
18256374 Endothelial dysfunction in chronic kidney disease may be partly mediated by advanced glycation end product-induced inhibition of endothelial nitric oxide synthase through RAGE activation.
18245812 Loss of RAGE contributes to idiopathic pulmonary fibrosis pathogenesis.
18231794 This preliminary study supports the hypothesis that the RAGE system might participate in the disease pathway of primary Sjogren's syndrome (SS), and that sRAGE may be a potential biomarker to aid in the diagnosis of primary SS.
18179750 the -374AA genotype of the RAGE gene promoter could be associated with a reduced risk of in-stent restenosis after coronary stent implantation
18089847 RAGE_v1 variant is the primary secreted soluble isoform of RAGE. identification of functional splice variants of RAGE underscores biological diversity of the RAGE gene & will aid in understanding of the gene in the normal & pathological state.
18080716 HCC during the early stage of tumorigenesis with less blood supply may acquire resistance to stringent hypoxic milieu by hypoxia-induced RAGE expression.
18079965 endothelial RAGE and its ligands mediate vascular and inflammatory stresses that culminate in atherosclerosis in the vulnerable vessel wall
18079485 Single nucleotide polymorphisms may contribute to development of glucose intolerance and type 2 diabetes.
18078623 HMGB-1 and BSA-AGE stimulated the invasiveness of fibroblast-like synoviocytes in rheumatoid arthritis by activation of RAGE.
18058469 serum sRAGE levels were influenced by genetic polymorphisms (-429 T/C, Gly82Ser and 2184 A/G) of the RAGE gene in breast cancer.
18050248 Calculating the S100A12:sRAGE ratio might help to detect patients with KD who are at risk of being unresponsive to IVIG therapy.
18046662 Plasma soluble RAGE and endogenous secretory RAGE are not associated with measures of diabetic neuropathy in type 2 diabetes patients.
18032526 Suggest key mechanisma by which AGER1 maintains cellular resistance against AGE-induced oxidative stress.
17924846 result confirms that the -374AA genotype of the RAGE gene promoter is a protective factor against the severity of coronary artery disease lesions in type 2 diabetic patients
17714874 De-N-glycosylation or G82S mutation of RAGE increases affinity for AGE ligands, and may sensitize cells or conditions with it to AGE.
17700210 Observational study of gene-disease association. (HuGE Navigator)
17661837 The receptor of advanced glycation end product (RAGE) -374 T/A single nucleotide polymorphism affected the dialysate-to-plasma ratio of creatinine at baseline, suggesting that the RAGE polymorphism may effect the basal peritoneal solute transport rate.
17660747 Structural and the binding data suggest that tetrameric S100B triggers RAGE activation by receptor dimerisation.
17640970 Data suggest that deregulation of RAGE expression in myoblasts might concur in rhabdomyosarcomagenesis and that increasing RAGE expression in rhabdomyosarcoma cells might reduce their tumor potential.
17639302 Treating type 2 diabetic patients with thiazolidinedione can increase circulating levels of RAGE.
17613396 Higher levels of plasma RAGE measured shortly after reperfusion predicted poor short-term outcomes from lung transplantation. Elevated plasma RAGE levels may have both pathogenetic and prognostic value in patients after lung transplantation.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17593216 Multivariate analysis showed high-grade expression of RAGE to be an independent prognostic factor for disease-free survival in oral squamous cell carcinoma.
17592553 Serum levels of sRAGE are associated with inflammatory markers in patients with type 2 diabetes.
17588956 RAGE was found throughout the testis, caput epididymis, particularly the principle cells apical region, and on sperm acrosomes in men with diabetes mellitus.
17560613 Olmesartan may play a protective role against proliferative diabetic retinopathy by attenuating the deleterious effects of AGEs via down-regulation of RAGE.
17549666 it is concluded that CDK5RAP3, CCNB2, and RAGE genes may be used as a very reliable biomarkers of lung adenocarcinoma
17536039 Data show that soluble RAGE blocks scavenger receptor CD36-mediated uptake of hypochlorite-modified low-density lipoprotein.
17512509 The -429 T>C polymorphism in the RAGE promoter is associated with type 1 diabetes in a Brazilian population, with a 2-fold increase of C-allele frequency compared to non-diabetic subjects
17508727 High level bacterial expression systems and purification protocols were generated for the extracellular region of RAGE (sRAGE) and the five permutations of single and tandem domain constructs.
17497647 Expression of Endogenous secretory receptor for advanced glycation endproducts was significantly higher in chondrosarcomas
17434489 Accumulation of AGE may have a role in the development of osteoarthritis.
17425804 the RAGE Ser82 allele does not predispose to cardiovascular events in rheumatoid arthritis.
17405935 evidence provided for activation of the NF-kappaB system in intervertebral discs in vivo which correlates with accumulated oxidative stress & increases in age & disc degeneration; oxidative stress may lead to RAGE activation & NF-kappaB translocation
17355942 Observational study of gene-disease association. (HuGE Navigator)
17345061 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17343760 Soluble but not sescretory protein is associated with albuminuria in type 2 diabetic paaatients, whil neither is associated with markers of glucose control or macrovascular disease.
17237617 We demonstrated that after successful TX, PAPP-A and sRAGE decrease and early chronic vascular changes in the kidney TX are associated with elevation of their serum levels.
17224333 subjects with homozygosity for the minor S allele of the G82S polymorphism of RAGE had higher risk factors for cardiovascular disease
17218539 study demonstrates that HOCl-modified albumin acts as a ligand for RAGE and promotes RAGE-mediated inflammatory complications
17172923 The results of this large population study demonstrate that the AA/GA genotypes of the RAGE +557G>A polymorphism are associated with a significantly decreased risk of significant coronary artery disease.
17170388 association of RAGE and its ligands with sarcoidosis and suggest that an intrinsic genetic factor could be in part involved in its expression. In Italian patients, the -374 T/A polymorphism seems to be significantly associated with this disease.
17158877 Soluble RAGE forms tetramers that bind to hexamers of Ca2+-calgranulin C, creating a large platform for effectively transmitting RAGE-dependent signals from extracellular S100 proteins to the cytoplasmic signaling complexes.
17035340 data suggest that the autocrine/paracrine release of HMGB1 and the integrity of the HMGB1/RAGE pathway are required for the migratory function of dendritic cells
17024691 Serum levels are significantly higher in type 2 diabetic patients than in non-diabetics and are positively associated with the presence of coronary artery disease.
17004092 Telmisartan: it may work as an anti-inflammatory agent against AGE by suppressing RAGE expression via PPAR-gamma activation in the liver.
16969649 Serum levels are associated with the severity of nephropathy in type 2 diabetic patients.
16969646 results show an association between the AGER -374 T/A polymorphism & type 1 diabetes; the polymorphism was associated with diabetic nephropathy in both type 1 & type 2 diabetes & with sight-threatening retinopathy in type 1 diabetic patients
16954682 observation suggests that the RAGE gene polymorphism is not associated with in-stent restenosis after coronary artery stenting in non-diabetic patients in the Korean population
16954185 AGER1 negatively regulates AGE-mediated oxidant stress-dependent signaling via the EGFR and Shc/Grb2/Ras pathway.
16899960 adhesion of red blood cells from type 2 diabetes patients was mediated by RAGE
16847147 CRP at concentrations known to predict future vascular events upregulates RAGE expression in human endothelial cells at both the protein and mRNA level. Silencing of the RAGE gene prevents CRP-induced macrophage chemoattractant protein 1 activation.
16728681 Observational study of gene-disease association. (HuGE Navigator)
16728681 3 AGER genetic variants: -429T>C, -374T>A, and Gly82Ser were determined in cerebral ischemia and stroke patients. Specific haplotypes were associated with reduced risk of incident myocardial infarction & ischemic stroke, independent of diabetes status.
16644647 Association of level in serum with albuminuria may be a marker of microvascular damage in type 2 diabetes.
16493495 The existence of splice variants of RAGE in endothelial cells might explain the lack of interaction of extracellular AGEs with endothelial cells.
16440015 study found a modest association with the -RAGE 374T/A polymorphism in the nonproliferative diabetic retinopathy subgroup
16374460 RAGE is mainly expressed in fibroblasts, dendrocytes, and keratinocytes and to a minor extent in endothelial and mononuclear cells.
16286548 Patients with Alzheimer disease have reduced levels of sRAGE in plasma compared with patients with vascular dementia and controls.
16271939 a cross-talk exists between the AGE-RAGE system and the angiotensin II receptor (renin-angiotensin system), and serum levels of sRAGE may reflect endothelial RAGE expression
16166741 Data suggest that re-expression of the receptor for advanced glycation end-products in lung cancer cells impairs the proliferative stimulus mediated by fibroblasts.
16159602 Analysis of specific manifestations of cardiovascular disease, including coronary heart disease (CHD), cardiovascular disease (CVD), myocardial infarction (MI) and ischemic disease (ISD) revealed no association with RAGE genotype.
16127291 These results suggest that RAGE expression appears to be closely associated with the invasiveness of oral squamous cell carcinoma and represents a promising candidate for assessing the future therapeutic potential in treating patients with oral carcinoma.
16061848 S100P plays a major role in the aggressiveness of pancreatic cancer that is likely mediated by its ability to activate RAGE
16052547 The increase in RAGE noted in osteoarthritis(OA) cartilage and the ability of RAGE ligands to stimulate chondrocyte MAP kinase and NF-kappaB activity and to stimulate MMP-13 production suggests that chondrocyte RAGE signaling could play a role in OA.
16037279 RAGE, an endogenous decoy receptor, may be related to individual variations in resistance to the development of diabetic vascular complications, observed in transgenic mice.
15986224 data suggests that the CML-RAGE-NF-kappaB pathway is an evident proinflammatory pathomechanism in mononuclear effector cells in polymyositis and dermatomyositis
15944249 Advanced glycosylation end-product receptor (RAGE) is required for the effect of high mobility group box 1 (HMGB1) on dendritic cells; HMGB1/RAGE interaction results in downstream activation of MAP kinases and NF-kappa B.
15942086 polymorphisms G1704T and G82S of the RAGE gene are not related to DR in Japanese type 2 diabetic patients.
15942078 polymorphisms G1704T and G82S of the RAGE gene are not related to DR in Japanese type 2 diabetic patients.
15930093 ACE inhibition reduces the accumulation of AGE in diabetes partly by increasing the production and secretion of sRAGE into plasma
15926115 data suggest that activation of the receptor for advanced glycation end products (RAGE) pathway may be one of the first steps in the pathogenesis of diabetic polyneuropathies
15915542 results reveal HMGB1 and RAGE as the first known autocrine loop modulating the maturation of plasmacytoid dendritic cells
15911356 Antibodies against RAGE receptor blocked Abeta-induced activation of the p38, JNK pathways, and NF-kappaB in CTL cybrids and offered protection against the neurotoxic effects of Abeta.
15896660 results show that the -374A allele (-374T>A polymorphism) in the RAGE gene is related to the susceptibility of developing ischemic heart disease in African-Brazilians with type 2 diabetes
15893388 Reactive oxygen species generated by the TNF-alpha-stimulated umbilical vein endothelial cells induce RAGE expression.
15803111 82 Serine allele of the RAGE gene is a risk allele for developing advanced nephropathy in diabettes mellitus.
15798956 data suggest that G1704T and G82S polymorphisms of the advanced glycation end product receptor (RAGE) gene are not related to microalbuminuria in Japanese type 2 diabetic patients
15790669 The RAGE2 haplotype is associated with diabetic nephropathy (DN) in type 2 diabetics and with earlier DN onset and can be regarded as a marker for DN.
15666359 DU145 cells, a hormone-independent prostate cancer cell line, showed the highest RAGE mRNA expression
15663911 RAGE, via its interaction with ligands, serves as a cofactor exacerbating diabetic vascular disease. (review)
15599399 data demonstrate that the RAGE-NF-kappaB axis operates in diabetic neuropathy, by mediating functional sensory deficits, and that its inhibition may provide new therapeutic approaches
15555779 RAGE may have multiple functions in the human brain, mediated by the individual or coordinated efforts of the different RAGE isoforms
15547674 374T/A polymorphism of the RAGE gene may reduce susceptibility to coronary artery disease
15539404 Down-regulation of RAGE may be considered as a critical step in tissue reorganization and the formation of lung tumours.
15448098 Thiazolidinedione antidiabetics modulate vascular endothelial RAGE expression.
15289604 AGER1 suppressed AGE mediated NF-kappaB and MAPK/p44/p42 activities and suppressed AGE-mediated mesangial cell inflammatory injury through negative regulation of RAGE
15247020 AGER has a role as a pleiotropic antagonistic gene (review)
15239215 RAGE and MMP-9 are expressed concordant with the metastatic ability of the human pancreatic cancer cells. Could be key to regulating metastatic ability of pancreatic cancer.
15213278 RAGE expression is upregulated on monocytes from patients with chronic kidney disease
15203887 Corellation of expression of tissue factor (TF) and the receptor for advanced glycation end products (RAGEs) and vascular complications in diabetic patients
15180953 Advanced glycation end products (AGE) by binding to AGE receptor (RAGE) per se could control mesangial cell growth.
15170618 the RAGE pathway plays a critical proinflammatory role in vasculitic neuropathy.
15155381 Review. RAGE is an amplification step in vascular inflammation and acceleration of atherosclerosis.
15127201 Findings using advanced glycosylation end products (AGEs) with strong RAGE-binding properties indicate that AGEs may not uniformly play a role in cellular activation.
15053925 Only cells expressing RAGE at the cell surface showed hypersensitivity to Abeta.
15052533 Patients with type 2 diabetes and the 63bp deletion in the promoter of RAGE seem to be protected from diabetic nephropathy.
15033494 AGER mediates S100A13 protein translocation in response to extracellular S100
15019601 results suggest that the decrease in monocyte RAGE expression can be at least partly accounted for by the ligand engagement and may be a factor contributing to the development of diabetic vascular complications
15009731 AGE might be involved in the growth and invasion of melanoma through interactions with RAGE and represent promising candidates for assessing the future therapeutic potential of this therapy in treating patients with melanoma.
14747204 RAGE G1704T polymorphisms may be useful in identifying the risk for developing diabetic nephropathy in type 2 diabetic patients.
14704946 Our study failed to demonstrate an association between either - 429 T/C or - 374 T/A gene polymorphism of the RAGE gene and diabetic retinopathy in Caucasians with type 2 diabetes
14595542 Oleate, not ligands of the receptor for advanced glycation end-products, acts as an enhancer of human smooth muscle cell proliferation.
14580673 identified three novel RAGE transcripts all encoding truncated soluble forms of RAGE. The relative expression ratios for the full-length RAGE transcript to the sum of its splice-variants encoding the soluble variants varied strongly among tissues.
12941744 No association betwween -429T/C and -37T/A polymorphism in RAGE gene promoter with diabetic retinopathy in NIDDM in Chinese patients
12935895 In vitro binding studies using a series of C-terminal deletion mutants of human RAGE revealed the importance of the membrane-proximal cytoplasmic region of RAGE for the direct ERK-RAGE interaction.
12859967 Results suggest a possible role of S100 protein- and RAGE-mediated signal transduction in the development of specific cancers.
12837757 AGEs can augment inflammatory responses by up-regulating COX-2 via RAGE and multiple signaling pathways, thereby leading to monocyte activation and vascular cell dysfunction
12651613 Advanced glycation end products and receptor for advanced glycation end products are found in AA amyloidosis.
12618340 The RAGE is expressed in dying neurons and suggest that RAGE may have a role in neuronal cell death mediated by ischemic stress.
12606536 association between -374 T/A RAGE polymorphism and cardiovascular disease and albumin excretion in type 1 diabetics with poor metabolic control suggests gene-environment interaction in development of diabetic nephropathy and cardiovascular complications
12598893 These data reinforce the importance of receptor for advanced glycation end products (RAGE)-ligand interactions in modulating properties of CD4+ T cells that infiltrate the central nervous system
12579287 co-expression of RAGE and amphoterin is closely associated with invasion and metastasis of colorectal cancer
12495433 Data show that vascular endothelial cells and pericytes express three novel splice variants of receptor for advanced glycation end-products (RAGE) mRNA.
12477623 There is an association of Gly82Ser polymorphism in this gene with diabetic retinopathy in type II diabetic Asian Indian patients.
12070776 increased prevalence of the 82S allele in patients with rheumatoid arthritis compared with control subjects
12029499 allele frequencies and genotype distribution combinations of four polymorphisms in the RAGE gene (6p21.3, G82S, 1704G/T, 2184A/G and 2245A/G) of 272 subjects (130 patients with plaque psoriasis and 142 healthy control).
11884895 Polymorphisms 1704G/T, 2184A/G, and 2245G/A in the rage gene are not associated with diabetic retinopathy in NIDDM
11811511 susceptibility to the development of chronic periodontitis could be influenced by the 1704G/T polymorphism of the RAGE gene, independently of diabetes
11739380 this study we have investigated a possible role of RAGE and amphoterin in the retinoic acid-induced differentiation of neuroblastoma cells.
11700025 mRNA and protein expression in Caco-2 cells

AA Sequence

MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGG      1 - 70
PWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNK     71 - 140
VGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSF    141 - 210
SPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPL    211 - 280
PPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGG    281 - 350
LGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP                    351 - 404
//

Text Mined References (678)

PMID Year Title
27026438 2016 Multi-walled carbon nanotube induces nitrative DNA damage in human lung epithelial cells via HMGB1-RAGE interaction and Toll-like receptor 9 activation.
27015414 2016 RAGE and TGF-?1 Cross-Talk Regulate Extracellular Matrix Turnover and Cytokine Synthesis in AGEs Exposed Fibroblast Cells.
26905625 2016 The Receptor for Advanced Glycation End Products (Rage) and Its Ligands in Plasma and Infrainguinal Bypass Vein.
26880860 2015 Role of the RAGE Axis during the Immune Response after Severe Trauma: A Prospective Pilot Study.
26873694 2016 Effects of receptor for advanced glycation endproducts on microvessel formation in endometrial cancer.
26828298 2016 Polymorphisms in the receptor for advanced glycation end products gene are associated with susceptibility to drug-resistant epilepsy.
26825459 2016 High Glucose Stimulates Tumorigenesis in Hepatocellular Carcinoma Cells Through AGER-Dependent O-GlcNAcylation of c-Jun.
26788516 2016 Expression of the Receptor for Advanced Glycation End Products in Epicardial Fat: Link with Tissue Thickness and Local Insulin Resistance in Coronary Artery Disease.
26782577 2015 Association between RAGE gene polymorphisms and ulcerative colitis susceptibility: a case-control study in a Chinese Han population.
26782423 2015 AGER genetic polymorphisms increase risks of breast and lung cancers.
26770981 2015 Association of 2184AG Polymorphism in the RAGE Gene with Diabetic Nephropathy in Chinese Patients with Type 2 Diabetes.
26758977 2016 The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis.
26745632 2016 RAGE and AGEs in Mild Cognitive Impairment of Diabetic Patients: A Cross-Sectional Study.
26682535 2016 Differential Receptor for Advanced Glycation End Products Expression in Preeclamptic, Intrauterine Growth Restricted, and Gestational Diabetic Placentas.
26664786 2015 Polymorphisms in three genes are associated with hemorrhagic stroke.
26657980 2016 Association between plasma soluble RAGE and renal function is unaffected by medication usage and enzymatic antioxidants in chronic kidney disease with type 2 diabetes.
26586913 2016 Advanced Glycation End Products (AGE) Potently Induce Autophagy through Activation of RAF Protein Kinase and Nuclear Factor ?B (NF-?B).
26569122 2016 Serum Levels of sRAGE Are Associated with Body Measurements, but Not Glycemic Parameters in Patients with Prediabetes.
26545872 2015 Antifibrotic properties of receptor for advanced glycation end products in idiopathic pulmonary fibrosis.
26502815 2015 The Possible Involvement of HLA Class III Haplotype (RAGE, HSP70 and TNF Genes) in Alzheimer's Disease.
26491690 2015 Soluble Receptor for Advanced Glycation End Product: A Biomarker for Acute Coronary Syndrome.
26472922 2015 Advanced Glycation End Products Affect Osteoblast Proliferation and Function by Modulating Autophagy Via the Receptor of Advanced Glycation End Products/Raf Protein/Mitogen-activated Protein Kinase/Extracellular Signal-regulated Kinase Kinase/Extracellular Signal-regulated Kinase (RAGE/Raf/MEK/ERK) Pathway.
26456846 2015 Functional promoter polymorphisms of the receptor for advanced glycation end products in children and adolescents with type 1 diabetes.
26436377 2015 Effect of RAGE polymorphisms on susceptibility to and severity of osteoarthritis in a Han Chinese population: a case-control study.
26429324 2015 Receptor for advanced glycation end products (RAGE) gene polymorphism and cardiovascular disease in end-stage renal disease patients.
26408307 2015 Soluble RAGE and atherosclerosis in youth with type 1 diabetes: a 5-year follow-up study.
26392152 2015 Contribution of dietary advanced glycation end products (AGE) to circulating AGE: role of dietary fat.
26391982 2015 HMGB1/RAGE induces IL-17 expression to exaggerate inflammation in peripheral blood cells of hepatitis B patients.
26382057 2016 Reduced expression of membrane-bound (m)RAGE is a biomarker of multiple sclerosis disease progression.
26349055 2016 Genetic polymorphisms of RAGE and risk of ulcerative colitis in a Chinese population.
26325204 2015 Serum Level of Soluble Receptor for Advanced Glycation End Products Is Associated with A Disintegrin And Metalloproteinase 10 in Type 1 Diabetes.
26316588 2015 Plasma miR-185 is decreased in patients with esophageal squamous cell carcinoma and might suppress tumor migration and invasion by targeting RAGE.
26313784 2015 Effects of RAGE Gene Polymorphisms on the Risk and Progression of Hepatocellular Carcinoma.
26303759 2015 HMGB1-RAGE signaling pathway in severe preeclampsia.
26274928 2015 Soluble Forms and Ligands of the Receptor for Advanced Glycation End-Products in Patients with Acute Respiratory Distress Syndrome: An Observational Prospective Study.
26261503 2015 Expression of HMGB1/RAGE protein in renal carcinoma and its clinical significance.
26253613 2015 RAGE Suppresses ABCG1-Mediated Macrophage Cholesterol Efflux in Diabetes.
26226616 2015 Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men.
26216409 2015 The receptor for advanced glycation end products and risk of peripheral arterial disease, amputation or death in type 2 diabetes: a population-based cohort study.
26211596 2015 Receptors for advanced glycation end products (RAGE) is associated with microvessel density and is a prognostic biomarker for clear cell renal cell carcinoma.
26202300 2015 HMGB1 binds to activated platelets via the receptor for advanced glycation end products and is present in platelet rich human coronary artery thrombi.
26193421 2015 The S100P/RAGE signaling pathway regulates expression of microRNA-21 in colon cancer cells.
26142969 2015 Elevated glycated albumin and reduced endogenous secretory receptor for advanced glycation endproducts levels in serum predict major adverse cardio-cerebral events in patients with type 2 diabetes and stable coronary artery disease.
26125438 2015 Extracellularly secreted APE1/Ref-1 triggers apoptosis in triple-negative breast cancer cells via RAGE binding, which is mediated through acetylation.
26114112 2015 Advanced Glycation End Products Enhance Macrophages Polarization into M1 Phenotype through Activating RAGE/NF-?B Pathway.
26083729 2015 Genetics of Plasma Soluble Receptor for Advanced Glycation End-Products and Cardiovascular Outcomes in a Community-based Population: Results from the Atherosclerosis Risk in Communities Study.
26078977 2015 Relationship of Soluble RAGE with Insulin Resistance and Beta Cell Function during Development of Type 2 Diabetes Mellitus.
26052716 2015 Serum Amyloid A Stimulates PKR Expression and HMGB1 Release Possibly through TLR4/RAGE Receptors.
26048613 2015 HMGB1 and RAGE in skeletal muscle inflammation: Implications for protein accumulation in inclusion body myositis.
26045736 2015 Relationship of advanced glycation end products and their receptor to pelvic organ prolapse.
26018980 2015 Diminished levels of the soluble form of RAGE are related to poor survival in malignant melanoma.
26011358 Association between the receptor for advanced glycation end products gene polymorphisms and cancer risk: a systematic review and meta-analysis.
26011179 2015 The RAGE receptor and its ligands are highly expressed in astrocytes in a grade-dependant manner in the striatum and subependymal layer in Huntington's disease.
25994997 2015 Relationship between serum levels of endogenous secretory RAGE and blood pressure in male nondiabetic patients with obstructive sleep apnea.
25974999 2015 Soluble receptor of advanced glycation end-products in patients with acute myocardial infarction treated with remote ischaemic conditioning.
25966147 2015 Decreased levels of soluble receptor for advanced glycation end-products in aortic valve calcification patients.
25956266 2015 The potential role of advanced glycation end products (AGEs) and soluble receptors for AGEs (sRAGE) in the pathogenesis of adult-onset still's disease.
25932660 2015 Soluble Receptor for Advanced Glycation End-Products Predicts Impaired Alveolar Fluid Clearance in Acute Respiratory Distress Syndrome.
25854354 2015 S100A12 and RAGE expression in human bladder transitional cell carcinoma: a role for the ligand/RAGE axis in tumor progression?
25832424 2015 C-reactive protein stimulates RAGE expression in human coronary artery endothelial cells in vitro via ROS generation and ERK/NF-?B activation.
25825217 2015 Circulating levels of soluble receptor for advanced glycation end products and ligands of the receptor for advanced glycation end products in patients with acute liver failure.
25811984 2015 S100A8/A9 stimulates keratinocyte proliferation in the development of squamous cell carcinoma of the skin via the receptor for advanced glycation-end products.
25802195 2015 Soluble receptor for advanced glycation end products as a potential biomarker to predict weight loss and improvement of insulin sensitivity by a very low calorie diet of obese human subjects.
25789318 2015 Association of polymorphisms of the receptor for advanced glycation end products gene and susceptibility to sporadic abdominal aortic aneurysm.
25786107 2015 Advanced glycation end products and oxidative stress in type 2 diabetes mellitus.
25772690 2015 High motility group box 1 (HMGB1) protein and its receptor for advanced glycation end products (RAGE) expression in chronic rhinosinusitis without nasal polyps.
25754382 2015 The role of receptor for advanced glycation end products in airway inflammation in CF and CF related diabetes.
25751734 2015 Isolevuglandin-type lipid aldehydes induce the inflammatory response of macrophages by modifying phosphatidylethanolamines and activating the receptor for advanced glycation endproducts.
25751601 2015 The HMGB1-RAGE Inflammatory Pathway: Implications for Brain Injury-Induced Pulmonary Dysfunction.
25744702 2015 Serum soluble RAGE levels and carotid atherosclerosis: the Northern Manhattan Study (NOMAS).
25744544 2015 RAGE Mediates the Pro-Migratory Response of Extracellular S100A4 in Human Thyroid Cancer Cells.
25724694 Expression pattern of RAGE and IGF-1 in the human fetal ovary and ovarian serous carcinoma.
25707513 2015 Association between the RAGE gene -374T/A, -429T/C polymorphisms and diabetic nephropathy: a meta-analysis.
25689357 2015 Regulation of RAGE splicing by hnRNP A1 and Tra2?-1 and its potential role in AD pathogenesis.
25684181 2015 Nuclear DAMP complex-mediated RAGE-dependent macrophage cell death.
25681682 2015 Age and genetic determinants of variation of circulating levels of the receptor for advanced glycation end products (RAGE) in the general human population.
25671828 Involvement of the receptor for advanced glycation end products in liver transplantation.
25652880 2015 Autophagy-mediated HMGB1 release promotes gastric cancer cell survival via RAGE activation of extracellular signal-regulated kinases 1/2.
25607269 sRAGE in septic shock: a potential biomarker of mortality.
25603950 2015 Association of RAGE polymorphisms and cancer risk: a meta-analysis of 27 studies.
25593504 2014 Induction of endothelial RAGE expression in pterygium.
25582438 2015 RAGE gene polymorphism and environmental factor in the risk of oral cancer.
25572331 2015 RAGE mediates S100A7-induced breast cancer growth and metastasis by modulating the tumor microenvironment.
25572180 2015 Rs1800625 in the receptor for advanced glycation end products gene predisposes to sepsis and multiple organ dysfunction syndrome in patients with major trauma.
25562186 2015 Dynamic changes in sRAGE levels and relationship with cardiac function in STEMI patients.
25531888 2015 Oxidized low-density lipoprotein promotes osteoblastic differentiation of valvular interstitial cells through RAGE/MAPK.
25509346 [Role of receptor for advanced glycation end-products in pathgenesis of psoriasis].
25503556 2015 Expression of the receptor for advanced glycation end products, a target for high mobility group box 1 protein, and its role in chronic recalcitrant rhinosinusitis with nasal polyps.
25499973 2015 sRAGE, inflammation, and risk of atrial fibrillation: results from the Atherosclerosis Risk in Communities (ARIC) Study.
25490770 2014 Receptor for advanced glycation end products - membrane type1 matrix metalloproteinase axis regulates tissue factor expression via RhoA and Rac1 activation in high-mobility group box-1 stimulated endothelial cells.
25470016 2015 Receptor for advanced glycation endproducts and progressive kidney disease.
25467215 2015 Advanced glycation end products (AGEs) and the soluble receptor for AGE (sRAGE) in patients with type 1 diabetes and coeliac disease.
25428166 2014 RAGE controls leukocyte adhesion in preterm and term infants.
25407489 2015 Polymorphisms of the receptor for advanced glycation end-products and glyoxalase I in patients with renal cancer.
25385222 2015 Molecular signaling of the HMGB1/RAGE axis contributes to cholesteatoma pathogenesis.
25355250 2015 Serum sRAGE as a potential biomarker for pediatric bronchiolitis: a pilot study.
25341034 2014 RAGE is essential for oncogenic KRAS-mediated hypoxic signaling in pancreatic cancer.
25330185 2014 Cell migration is regulated by AGE-RAGE interaction in human oral cancer cells in vitro.
25310905 2014 The receptor for advanced glycation end products influences the expression of its S100 protein ligands in melanoma tumors.
25231638 2014 Circulating soluble receptor for advanced glycation end product identifies patients with bicuspid aortic valve and associated aortopathies.
25223881 2015 Modulation of immune response by RAGE and TLR4 signalling in PBMCs of diabetic and non-diabetic patients.
25186179 2014 The HMGB1-RAGE axis mediates traumatic brain injury-induced pulmonary dysfunction in lung transplantation.
25147225 2015 Association of plasma levels of soluble receptor for advanced glycation end products and risk of kidney disease: the Atherosclerosis Risk in Communities study.
25123133 2014 Defective RAGE activity in embryonal rhabdomyosarcoma cells results in high PAX7 levels that sustain migration and invasiveness.
25114379 2014 Overexpression of receptor for advanced glycation end products and high-mobility group box 1 in human dental pulp inflammation.
25044082 2014 Elevation of soluble form of receptor for advanced glycation end products (sRAGE) in recurrent pregnancy losses (RPL): possible participation of RAGE in RPL.
25043528 2014 Prognostic significance of receptor for advanced glycation end products expression in hepatocellular carcinoma after hepatectomy.
25039001 2014 The axis AGE-RAGE-soluble RAGE and oxidative stress in chronic kidney disease.
25031745 2014 Concurrent alterations of RAGE, RECK, and MMP9 protein expression are relevant to Epstein-Barr virus infection, metastasis, and survival in nasopharyngeal carcinoma.
25016700 2014 Serum level of soluble receptor for advanced glycation end products in asthmatic children and its correlation to severity and pulmonary functions.
25014735 2015 Inflammatory risk factors and pathologies promoting Alzheimer's disease progression: is RAGE the key?
25012910 2014 Serum levels of soluble receptor for advanced glycation end-products and metabolic syndrome: the Northern Manhattan Study.
25002577 2014 DNAX-activating protein 10 (DAP10) membrane adaptor associates with receptor for advanced glycation end products (RAGE) and modulates the RAGE-triggered signaling pathway in human keratinocytes.
24984291 2014 Role of advanced glycation end product (AGE)-induced receptor (RAGE) expression in diabetic vascular complications.
24982031 2014 Interaction of S100A13 with C2 domain of receptor for advanced glycation end products (RAGE).
24978055 2015 Receptor for advanced glycation end-products regulates lung fluid balance via protein kinase C-gp91(phox) signaling to epithelial sodium channels.
24971542 2014 HMGB1-DNA complex-induced autophagy limits AIM2 inflammasome activation through RAGE.
24952599 2014 RAGE mediates S100A4-induced cell motility via MAPK/ERK and hypoxia signaling and is a prognostic biomarker for human colorectal cancer metastasis.
24934531 2014 [The role of selected cytokines and proteins analyzed in bronchoalveolar lavage fluid in lung injury].
24887223 2014 Contribution of damage-associated molecular patterns to transfusion-related acute lung injury in cardiac surgery.
24870978 2014 The receptor for advanced glycation end-products (RAGE) plays a key role in the formation of nanotubes (NTs) between peritoneal mesothelial cells and in murine kidneys.
24839222 2014 Association between endogenous secretory receptor for advanced glycation-end products (esRAGE) and carotid intima-media thickness in type 2 diabetes.
24824951 2014 The receptor for advanced glycation end products (RAGE) specifically recognizes methylglyoxal-derived AGEs.
24776932 2014 Impact of serum high mobility group box 1 and soluble receptor for advanced glycation end-products on subclinical atherosclerosis in patients with granulomatosis with polyangiitis.
24744309 2014 Dietary intake of advanced glycation end products did not affect endothelial function and inflammation in healthy adults in a randomized controlled trial.
24742661 2014 Circulating concentrations of soluble receptor for AGE are associated with age and AGER gene polymorphisms in children with newly diagnosed type 1 diabetes.
24740401 2014 Cross-sectional analysis of obesity and serum analytes in males identifies sRAGE as a novel biomarker inversely associated with diverticulosis.
24727234 2014 Comparison of effects of pioglitazone and glimepiride on plasma soluble RAGE and RAGE expression in peripheral mononuclear cells in type 2 diabetes: randomized controlled trial (PioRAGE).
24705787 2014 Expression of RAGE and HMGB1 in thymic epithelial tumors, thymic hyperplasia and regular thymic morphology.
24697697 2014 Expression and subcellular localization of RAGE in melanoma cells.
24656601 2014 Correlation between cerebral microbleeds and S100B/RAGE in acute lacunar stroke patients.
24625976 2014 D-ribosylation induces cognitive impairment through RAGE-dependent astrocytic inflammation.
24619131 2014 The relationship between RAGE gene four common polymorphisms and breast cancer risk in northeastern Han Chinese.
24613454 2014 RAGE overexpression confers a metastatic phenotype to the WM115 human primary melanoma cell line.
24605038 2014 RAGE gene three polymorphisms with Crohn's disease susceptibility in Chinese Han population.
24603633 2014 Decreased level of sRAGE in the cerebrospinal fluid of multiple sclerosis patients at clinical onset.
24564838 2014 Association of plasma sRAGE, but not esRAGE with lung function impairment in COPD.
24554430 2014 RAGE signaling deficiency in rhabdomyosarcoma cells causes upregulation of PAX7 and uncontrolled proliferation.
24535058 2014 Overexpression of RAGE contributes to cigarette smoke-induced nitric oxide generation in COPD.
24526523 2014 Genetic ablation of receptor for advanced glycation end products promotes functional recovery in mouse model of spinal cord injury.
24520905 2014 Association of polymorphisms of the receptor for advanced glycation end products gene with COPD in the Chinese population.
24515114 2014 Targeting of receptor for advanced glycation end products suppresses cyst growth in polycystic kidney disease.
24510323 2014 The role of HMGB1-RAGE axis in migration and invasion of hepatocellular carcinoma cell lines.
24486339 2014 P2Y(2)R activation by nucleotides released from oxLDL-treated endothelial cells (ECs) mediates the interaction between ECs and immune cells through RAGE expression and reactive oxygen species production.
24484607 2014 Monomeric A?1-42 and RAGE: key players in neuronal differentiation.
24474694 2014 An immunogenic peptide in the A-box of HMGB1 protein reverses apoptosis-induced tolerance through RAGE receptor.
24472555 2014 Ascorbate reverses high glucose- and RAGE-induced leak of the endothelial permeability barrier.
24441189 2013 Knockdown of RAGE inhibits growth and invasion of gastric cancer cells.
24427342 2014 Advanced glycation end-products and receptor for advanced glycation end-products expression in patients with idiopathic pulmonary fibrosis and NSIP.
24420130 2014 [Therapeutic strategies for RAGE-mediated diseases].
24418399 2014 Association of RAGE gene polymorphism with vascular complications in Indian type 2 diabetes mellitus patients.
24397807 2014 Decreased level of endogenous secretory receptor for advanced glycation end-products in diabetes with concomitant hyperlipidemia.
24395344 2014 Cutaneous activation of rage in nonsystemic vasculitic and diabetic neuropathy.
24373844 2014 GeneOptimizer program-assisted cDNA reengineering enhances sRAGE autologous expression in Chinese hamster ovary cells.
24363518 2013 Role of the advanced glycation end products receptor in Crohn's disease inflammation.
24329736 2015 Association of soluble receptor for advanced glycation end products levels with hypertensive albuminuria.
24304868 2014 Association of RAGE gene polymorphisms with sporadic Parkinson's disease in Chinese Han population.
24303922 2013 Upregulation of S100P, receptor for advanced glycation end products and ezrin in malignant melanoma.
24303504 2013 Association of the receptor for advanced glycation end products gene polymorphisms and circulating RAGE levels with diabetic retinopathy in the Chinese population.
24302816 2013 HMGB1 acts in synergy with lipopolysaccharide in activating rheumatoid synovial fibroblasts via p38 MAPK and NF-?B signaling pathways.
24284407 2013 Possible role of -374T/A polymorphism of RAGE gene in longevity.
24276462 2014 Follicular fluid soluble receptor for advanced glycation end-products (sRAGE): a potential indicator of ovarian reserve.
24276448 2014 Lower serum endogenous secretory receptor for advanced glycation end product level as a risk factor of metabolic syndrome among Japanese adult men: a 2-year longitudinal study.
24273313 2013 Complex tissue-specific patterns and distribution of multiple RAGE splice variants in different mammals.
24260107 2013 Alternative splicing of the RAGE cytoplasmic domain regulates cell signaling and function.
24252909 2013 Hyperoside downregulates the receptor for advanced glycation end products (RAGE) and promotes proliferation in ECV304 cells via the c-Jun N-terminal kinases (JNK) pathway following stimulation by advanced glycation end-products in vitro.
24248547 2014 Gly82Ser polymorphism of the receptor for advanced glycation end-product (RAGE) potential high risk in patients with colorectal cancer.
24231387 2013 The AGE-RAGE pathway and its relation to cardiovascular disease in patients with chronic kidney disease.
24228859 2014 Streptozotocin-induced diabetes increases amyloid plaque deposition in AD transgenic mice through modulating AGEs/RAGE/NF-?B pathway.
24228009 2013 Soluble RAGE plasma levels in patients with coronary artery disease and peripheral artery disease.
24217195 2013 Plasma advanced glycation end products (AGEs), receptors for AGEs and their correlation with inflammatory markers in middle school-age children.
24188108 2013 Placental growth factor, pregnancy-associated plasma protein-A, soluble receptor for advanced glycation end products, extracellular newly identified receptor for receptor for advanced glycation end products binding protein and high mobility group box 1 levels in patients with acute kidney injury: a cross sectional study.
24177755 2013 RAGE-binding S100A8/A9 promotes the migration and invasion of human breast cancer cells through actin polymerization and epithelial-mesenchymal transition.
24156267 2013 The human leukocyte antigen class III haplotype approach: new insight in Alzheimer's disease inflammation hypothesis.
24155913 2013 An interactive association of advanced glycation end-product receptor gene four common polymorphisms with coronary artery disease in northeastern Han Chinese.
24133579 2013 Impact of hyperglycemia and acute pancreatitis on the receptor for advanced glycation endproducts.
24119142 2013 Structural insights into the oligomerization mode of the human receptor for advanced glycation end-products.
24113348 2014 Receptor for advanced glycation end-products promotes premature senescence of proximal tubular epithelial cells via activation of endoplasmic reticulum stress-dependent p21 signaling.
24107402 2013 Polymorphism of the RAGE affects the serum inflammatory levels and risk of ischemic stroke in a Chinese population.
24081950 2013 RAGE is a nucleic acid receptor that promotes inflammatory responses to DNA.
24078092 2013 Association between the receptor for advanced glycation end products gene polymorphisms and coronary artery disease.
24058542 2013 Fluorescent advanced glycation end products and their soluble receptor: the birth of new plasmatic biomarkers for risk stratification of acute coronary syndrome.
23975852 2013 The galectin-3/RAGE dyad modulates vascular osteogenesis in atherosclerosis.
23973487 2013 Two ?-strands of RAGE participate in the recognition and transport of amyloid-? peptide across the blood brain barrier.
23954397 2013 RAGE and TLRs: relatives, friends or neighbours?
23947473 2013 Systemic soluble receptor for advanced glycation endproducts is a biomarker of emphysema and associated with AGER genetic variants in patients with chronic obstructive pulmonary disease.
23911608 2013 HMGB1 induces an inflammatory response in endothelial cells via the RAGE-dependent endoplasmic reticulum stress pathway.
23894685 2013 Association of four genetic polymorphisms of AGER and its circulating forms with coronary artery disease: a meta-analysis.
23874853 2013 Contributory role of five common polymorphisms of RAGE and APE1 genes in lung cancer among Han Chinese.
23867237 2013 Increased receptor for advanced glycation end product expression in the human alcoholic prefrontal cortex is linked to adolescent drinking.
23861159 2013 Efficacy of alogliptin, a dipeptidyl peptidase-4 inhibitor, on glucose parameters, the activity of the advanced glycation end product (AGE) - receptor for AGE (RAGE) axis and albuminuria in Japanese type 2 diabetes.
23855502 2014 The potential mechanisms of A?-receptor for advanced glycation end-products interaction disrupting tight junctions of the blood-brain barrier in Alzheimer's disease.
23759926 2013 N(?)-Carboxymethyllysine (CML), a Maillard reaction product, stimulates serotonin release and activates the receptor for advanced glycation end products (RAGE) in SH-SY5Y cells.
23755764 Clinical significance of immunogenic cell death biomarker rage and early growth response 1 in human primary gastric adenocarcinoma.
23729200 2013 Circulating nucleosomes and immunogenic cell death markers HMGB1, sRAGE and DNAse in patients with advanced pancreatic cancer undergoing chemotherapy.
23721855 2013 Association of RAGE gene polymorphism with circulating AGEs level and paraoxonase activity in relation to macro-vascular complications in Indian type 2 diabetes mellitus patients.
23712703 2013 The activation of HMGB1 as a progression factor on inflammation response in normal human bronchial epithelial cells through RAGE/JNK/NF-?B pathway.
23693020 2013 S100P/RAGE signaling regulates microRNA-155 expression via AP-1 activation in colon cancer.
23628898 2013 Immune complexes activate human endothelium involving the cell-signaling HMGB1-RAGE axis in the pathogenesis of lupus vasculitis.
23593165 2013 -374 T/A RAGE polymorphism is associated with chronic kidney disease progression in subjects affected by nephrocardiovascular disease.
23579957 2013 Specific siRNA targeting receptor for advanced glycation end products (RAGE) decreases proliferation in human breast cancer cell lines.
23571222 2013 Polymorphisms of receptor for advanced glycation end products and risk of epithelial ovarian cancer in Chinese patients.
23559480 2013 RAGE inhibits human respiratory syncytial virus syncytium formation by interfering with F-protein function.
23552832 2013 Soluble receptor for advanced glycation end-product (sRAGE)/pentosidine ratio: a potential risk factor determinant for type 2 diabetic retinopathy.
23545311 2013 Receptor for advanced glycation end-product (RAGE) gene polymorphism 2245G/A is associated with pro-inflammatory, oxidative-glycation markers and sRAGE in diabetic retinopathy.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23527722 RAGE gene polymorphism in heart failure patients with and without angiographic evidence of significant coronary atherosclerosis.
23525442 2013 Critical role for the advanced glycation end-products receptor in pulmonary arterial hypertension etiology.
23523633 2013 Receptor for Advanced Glycation Endproducts is upregulated in temporal lobe epilepsy and contributes to experimental seizures.
23508966 2013 Sodium-glucose cotransporter 2-mediated oxidative stress augments advanced glycation end products-induced tubular cell apoptosis.
23466064 2013 Possible participation of receptor for advanced glycation end products (RAGE) in the origin of cancer stem cells in diabetic patients with colon cancer.
23432638 2013 Effect of insulin on the soluble receptor for advanced glycation end products (RAGE).
23426492 2013 Influence of cyclosporin and prednisolone on RAGE, S100A8/A9, and NF?B expression in human keratinocytes.
23421467 2013 Low molecular weight heparin suppresses receptor for advanced glycation end products-mediated expression of malignant phenotype in human fibrosarcoma cells.
23398829 2013 Receptor for advanced glycation end products (RAGE), inflammatory ligand EN-RAGE and soluble RAGE (sRAGE) in subjects with Takayasu's arteritis.
23340902 2013 Immunohistochemical expression of RAGE and its ligand (S100A9) in cervical lesions.
23331756 2013 Early plasma soluble receptor for advanced glycation end-product levels are associated with bronchiolitis obliterans syndrome.
23325627 2013 Soluble receptor for advanced glycation end products and risk of liver cancer.
23318458 2014 The HMGB1/RAGE inflammatory pathway promotes pancreatic tumor growth by regulating mitochondrial bioenergetics.
23288172 2013 Functional role of soluble receptor for advanced glycation end products in stroke.
23284645 2012 Disulfide bonds within the C2 domain of RAGE play key roles in its dimerization and biogenesis.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23275625 2013 The receptor for advanced glycation end products mediates lung endothelial activation by RBCs.
23254359 2013 DOCK7 is a critical regulator of the RAGE-Cdc42 signaling axis that induces formation of dendritic pseudopodia in human cancer cells.
23252485 2013 Genetic variation in the receptor for advanced glycation end-products (RAGE) gene and ischaemic stroke.
23236395 2012 Meta-analysis of RAGE gene polymorphism and coronary heart disease risk.
23228658 2013 Decreased plasma levels of soluble low density lipoprotein receptor-related protein-1 (sLRP) and the soluble form of the receptor for advanced glycation end products (sRAGE) in the clinical diagnosis of Alzheimer's disease.
23218576 2013 Asymmetrical dimethylarginine level is independently associated with circulating levels of RAGE and PEDF.
23206470 2012 Circulating soluble receptor for advanced glycation end products is inversely correlated to oxidized low-density lipoproteins in asymptomatic subjects.
23182709 2013 The immunobiology of the receptor of advanced glycation end-products: trends and challenges.
23171632 2012 Reverse regulation of soluble receptor for advanced glycation end products and proinflammatory factor resistin and S100A12 in Kawasaki disease.
23144152 2012 The interaction between RAGE gene polymorphisms and HPV infection in determining the susceptibility of cervical cancer in a Chinese population.
23103427 2013 RAGE in tissue homeostasis, repair and regeneration.
23091285 2013 Pentosidine as a biomarker for microvascular complications in type 2 diabetic patients.
23071492 2012 RAGE genetic polymorphisms are associated with risk, chemotherapy response and prognosis in patients with advanced NSCLC.
22989605 2013 Decreased endogenous secretory RAGE and increased hsCRP levels in serum are associated with atrial fibrillation in patients undergoing coronary angiography.
22987041 2012 The interaction between obesity and RAGE polymorphisms on the risk of knee osteoarthritis in Chinese population.
22983919 2013 Circulating immunogenic cell death biomarkers HMGB1 and RAGE in breast cancer patients during neoadjuvant chemotherapy.
22966766 2013 -374 T/A polymorphism in RAGE gene is associated with onset of diabetes mellitus, atherosclerosis, and renal dysfunction in patients with hypertension.
22965881 2012 Predictive value of immunogenic cell death biomarkers HMGB1, sRAGE, and DNase in liver cancer patients receiving transarterial chemoembolization therapy.
22964273 2012 Association study of polymorphisms in the receptor for advanced glycation end-products (RAGE) gene with susceptibility and prognosis of heart failure.
22960399 2012 HMGB1 and RAGE levels in induced sputum correlate with asthma severity and neutrophil percentage.
22920235 2013 Serum soluble receptor for advanced glycation end products levels and aortic augmentation index in early rheumatoid arthritis--a prospective study.
22900949 2012 Reduced soluble receptor for advanced glycation end-products (sRAGE) scavenger capacity precedes pre-eclampsia in Type 1 diabetes.
22863784 2012 Effect of advanced glycation end products on lectin-like oxidized low density lipoprotein receptor-1 expression in endothelial cells.
22860029 2012 AGER -429T/C is associated with an increased lung disease severity in cystic fibrosis.
22860017 2012 Induction of RAGE shedding by activation of G protein-coupled receptors.
22843047 2012 Inhibitory effect of alternatively spliced RAGEv1 on the expression of NF-kB and TNF-? in hepatocellular carcinoma cells.
22837190 2012 Effects of exercise on sRAGE levels and cardiometabolic risk factors in patients with type 2 diabetes: a randomized controlled trial.
22835520 2012 Elevated serum levels of AGEs, sRAGE, and pentosidine in Tunisian patients with severity of diabetic retinopathy.
22827914 2012 Identification of haplotype tag single nucleotide polymorphisms within the receptor for advanced glycation end products gene and their clinical relevance in patients with major trauma.
22785051 2012 Inverse association between circulating levels of soluble receptor for advanced glycation end-products and coronary plaque burden.
22777515 2012 The receptor for advanced glycation end products and acute lung injury/acute respiratory distress syndrome.
22771726 2012 Receptor for advanced glycation end products (RAGE) and glyoxalase I gene polymorphisms in pathological pregnancy.
22754344 2012 The Role of receptor for Advanced Glycation End Products (RAGE) in the proliferation of hepatocellular carcinoma.
22652038 2012 Adiponectin is inversely associated with ratio of serum levels of AGEs to sRAGE and vascular inflammation.
22633675 2012 Decreased serum endogenous secretory receptor for advanced glycation endproducts and increased cleaved receptor for advanced glycation endproducts levels in patients with atrial fibrillation.
22616947 2012 Plasma sRAGE enables prediction of acute lung injury after cardiac surgery in children.
22578261 2012 Clinical chorioamnionitis is characterized by changes in the expression of the alarmin HMGB1 and one of its receptors, sRAGE.
22553402 2012 Glycer-AGEs-RAGE signaling enhances the angiogenic potential of hepatocellular carcinoma by upregulating VEGF expression.
22513366 2012 Receptor for advanced glycation end products (RAGE) polymorphisms are associated with systemic lupus erythematosus and disease severity in lupus nephritis.
22509345 2012 RAGE expression in human T cells: a link between environmental factors and adaptive immune responses.
22509024 2012 The expression of the receptor for advanced glycation endproducts (RAGE) is permissive for early pancreatic neoplasia.
22490537 2012 [Effects of advanced glycation end products and its receptor on oxidative stress in diabetic wounds].
22475522 2012 Association of RAGE gene polymorphisms with type 2 diabetes mellitus, diabetic retinopathy and diabetic nephropathy.
22473704 2012 HMGB1 conveys immunosuppressive characteristics on regulatory and conventional T cells.
22460069 2012 RAGE processing in chronic airway conditions: involvement of Staphylococcus aureus and ECP.
22427038 2012 Lack of association between Gly82Ser, 1704G/T and 2184A/G of RAGE gene polymorphisms and retinopathy susceptibility in Malaysian diabetic patients.
22417726 2012 AGEs-RAGE mediated up-regulation of connexin43 in activated human microglial CHME-5 cells.
22405771 2012 The receptor for advanced glycation endproducts and its ligands in patients with myasthenia gravis.
22402134 2012 A meta-analysis of receptor for advanced glycation end products gene: four well-evaluated polymorphisms with diabetes mellitus.
22386596 2012 RAGE binds C1q and enhances C1q-mediated phagocytosis.
22382005 2012 Peripheral RAGE (receptor for advanced glycation endproducts)-ligands in normal pregnancy and preeclampsia: novel markers of inflammatory response.
22366088 2012 Analysis of AGE modified proteins and RAGE expression in HER2/neu negative invasive ductal carcinoma.
22354095 2012 Association of the receptor for advanced glycation end products gene polymorphisms with diabetic retinopathy in type 2 diabetes: a meta-analysis.
22353366 2012 Association study of AGER gene polymorphism and hypertension in Han Chinese population.
22339587 2012 The soluble receptor for advanced glycation end products can prospectively identify patients at greatest risk for preterm birth.
22337892 2012 Soluble RAGE and malondialdehyde in type 1 diabetes patients without chronic complications during the course of the disease.
22315985 2012 Could receptors for advanced glycation end products be considered cardiovascular risk markers in obese children?
22264245 2012 Soluble RAGE as a severity marker in community acquired pneumonia associated sepsis.
22229442 2012 Involvement of RAGE, MAPK and NF-?B pathways in AGEs-induced MMP-9 activation in HaCaT keratinocytes.
22212601 2013 Soluble receptor for advanced glycation end-product levels are related to albuminuria and arterial stiffness in essential hypertension.
22211895 2011 Receptor for AGE (RAGE): signaling mechanisms in the pathogenesis of diabetes and its complications.
22206663 2012 Targeting receptor for advanced glycation end products (RAGE) expression induces apoptosis and inhibits prostate tumor growth.
22194616 2012 Signal transduction in receptor for advanced glycation end products (RAGE): solution structure of C-terminal rage (ctRAGE) and its binding to mDia1.
22189627 2012 Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation.
22154374 2012 Association analysis of -429T/C and -374T/A polymorphisms of receptor of advanced glycation end products (RAGE) gene in Malaysian with type 2 diabetic retinopathy.
22146151 2012 Is the Gly82Ser polymorphism in the RAGE gene relevant to schizophrenia and the personality trait psychoticism?
22137663 2012 Association between sRAGE, esRAGE levels and vascular inflammation: analysis with (18)F-fluorodeoxyglucose positron emission tomography.
22116960 2012 2245G/A polymorphism of the receptor for advanced glycation end-products (RAGE) gene is associated with diabetic retinopathy in the Malaysian population.
22114731 2011 Genetically-determined hyperfunction of the S100B/RAGE axis is a risk factor for aspergillosis in stem cell transplant recipients.
22097731 2011 [The effect of valsartan on the expression of the receptor for advanced glycation end products in human glomerular mesangial cells].
22072229 2011 Elevated soluble receptor for advanced glycation end product levels in patients with acute coronary syndrome and positive cardiac troponin I.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
22025532 2011 Human eosinophils express RAGE, produce RAGE ligands, exhibit PKC-delta phosphorylation and enhanced viability in response to the RAGE ligand, S100B.
22012330 2012 Differential activation of RAGE by HMGB1 modulates neutrophil-associated NADPH oxidase activity and bacterial killing.
21990362 2011 Heparan sulfate is essential for high mobility group protein 1 (HMGB1) signaling by the receptor for advanced glycation end products (RAGE).
21978883 2011 Role of A?-receptor for advanced glycation endproducts interaction in oxidative stress and cytosolic phospholipase A? activation in astrocytes and cerebral endothelial cells.
21965014 2011 Effect of five genetic variants associated with lung function on the risk of chronic obstructive lung disease, and their joint effects on lung function.
21947881 2012 Is there any association between GLY82 ser polymorphism of rage gene and Turkish diabetic and non diabetic patients with coronary artery disease?
21947243 2012 Receptor for advanced glycation end products (RAGE) partially mediates HMGB1-ERKs activation in clear cell renal cell carcinoma.
21945853 2011 Knockdown of RAGE expression inhibits colorectal cancer cell invasion and suppresses angiogenesis in vitro and in vivo.
21941211 2011 Levels of soluble advanced glycation end product-receptors and other soluble serum markers as indicators of diabetic neuropathy in the foot.
21920897 2012 Soluble RAGE is deficient in neutrophilic asthma and COPD.
21914366 2011 [Changes of HMGB1 and RAGE in induced sputum from patients with bronchial asthma].
21906738 2012 Plasma levels of soluble receptor for advanced glycation end products (sRAGE) and proinflammatory ligand for RAGE (EN-RAGE) are associated with carotid atherosclerosis in patients with peritoneal dialysis.
21872861 2011 Low plasma levels of the soluble receptor for advanced glycation end products in HIV-infected patients with subclinical carotid atherosclerosis receiving combined antiretroviral therapy.
21871056 2011 sRAGE in diabetic and non-diabetic critically ill patients: effects of intensive insulin therapy.
21865159 2011 Solution structure of the soluble receptor for advanced glycation end products (sRAGE).
21861709 2012 Associations of receptor for advanced glycation end products -374 T/A and Gly82 Ser and peroxisome proliferator-activated receptor gamma Pro12Ala polymorphisms in Turkish coronary artery disease patients.
21844192 2011 Receptor for advanced glycation end products (RAGE) prevents endothelial cell membrane resealing and regulates F-actin remodeling in a beta-catenin-dependent manner.
21829704 2011 TIRAP, an adaptor protein for TLR2/4, transduces a signal from RAGE phosphorylated upon ligand binding.
21771973 2011 Total soluble and endogenous secretory receptor for advanced glycation end products as predictive biomarkers of coronary heart disease risk in patients with type 2 diabetes: an analysis from the CARDS trial.
21767223 2011 Clinical significance of serum sRAGE and esRAGE in women with normal pregnancy and preeclampsia.
21749686 2011 The expression of the receptor for advanced glycation end-products (RAGE) in RA-FLS is induced by IL-17 via Act-1.
21736957 2011 Kinetics of plasma SPB and RAGE during mechanical ventilation in patients undergoing major vascular surgery.
21724696 2011 Soluble receptor for advanced glycation endproducts is decreased in patients with juvenile idiopathic arthritis (ERA category) and inversely correlates with disease activity and S100A12 levels.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21680901 2011 RAGE-dependent activation of the oncoprotein Pim1 plays a critical role in systemic vascular remodeling processes.
21617715 Interaction effect between the receptor for advanced glycation end products (RAGE) and high-mobility group box-1 (HMGB-1) for the migration of a squamous cell carcinoma cell line.
21609778 2011 Evidence of involvement of the receptor for advanced glycation end-products (RAGE) in the adhesion of Helicobacter pylori to gastric epithelial cells.
21576827 2011 Soluble receptor of advanced glycated endproducts is associated with plaque vulnerability in patients with acute myocardial infarction.
21565706 2011 Advanced glycation end product recognition by the receptor for AGEs.
21559403 2011 S100A14 stimulates cell proliferation and induces cell apoptosis at different concentrations via receptor for advanced glycation end products (RAGE).
21540233 2011 Evidence that serum levels of the soluble receptor for advanced glycation end products are inversely associated with pancreatic cancer risk: a prospective study.
21527578 2011 Advanced glycation end products, soluble receptor for advanced glycation end products, and risk of colorectal cancer.
21521347 2011 Association of AGER gene G82S polymorphism with the severity of coronary artery disease in Chinese Han population.
21512281 2011 Activation of receptor for advanced glycation end products induces osteogenic differentiation of vascular smooth muscle cells.
21511948 2011 The G82S polymorphism promotes glycosylation of the receptor for advanced glycation end products (RAGE) at asparagine 81: comparison of wild-type rage with the G82S polymorphic variant.
21511691 2011 A functional p.82G>S polymorphism in the RAGE gene is associated with multiple sclerosis in the Chinese population.
21472688 2011 Role of cannabinoid receptors and RAGE in inflammatory bowel disease.
21472666 2011 RAGE-dependent regulation of calcium-binding proteins S100A8 and S100A9 in human THP-1.
21450369 2012 AGEs induce Alzheimer-like tau pathology and memory deficit via RAGE-mediated GSK-3 activation.
21450080 2011 Soluble receptor for advanced glycation end products in COPD: relationship with emphysema and chronic cor pulmonale: a case-control study.
21432860 2011 Calcium channel blocker inhibition of AGE and RAGE axis limits renal injury in nondiabetic patients with stage I or II chronic kidney disease.
21389696 2011 Endogenous secretory receptor for advanced glycation end products and chronic kidney disease in the elderly population.
21365018 2011 Expression of high-mobility groups box-1/receptor for advanced glycation end products/osteopontin/early growth response-1 pathway in proliferative vitreoretinal epiretinal membranes.
21357189 2011 Endogenous secretory receptor for advanced glycation end products is associated with low serum interleukin-1 receptor antagonist and elevated IL-6 in older community-dwelling adults.
21325454 2011 Activation of the receptor for advanced glycation end products system in women with severe preeclampsia.
21317562 2011 RAGE regulates autophagy and apoptosis following oxidative injury.
21316677 2011 Association of serum soluble receptor for advanced glycation end-products with subclinical cerebrovascular disease: the Northern Manhattan Study (NOMAS).
21311028 2011 The functional -374T/A polymorphism of the receptor for advanced glycation end products may modulate Crohn's disease.
21303685 2011 Toll-like receptor signaling in amyotrophic lateral sclerosis spinal cord tissue.
21298413 2011 Receptor for advanced glycation end-products (RAGE) provides a link between genetic susceptibility and environmental factors in type 1 diabetes.
21297263 2011 Genetic association of sequence variants near AGER/NOTCH4 and dementia.
21282351 2011 Receptor for advanced glycation end-products expression in subcutaneous adipose tissue is related to coronary artery disease.
21278261 2011 Interplay between RAGE, CD44, and focal adhesion molecules in epithelial-mesenchymal transition of alveolar epithelial cells.
21257730 2011 Proteolytic release of the receptor for advanced glycation end products from in vitro and in situ alveolar epithelial cells.
21254849 2011 AGER gene -374T>A (rs1800624) polymorphism is not associated with the severity of non-diabetic coronary artery disease in Han Chinese.
21254649 2010 [Expression of RECK, RAGE and MMP-9 in nasopharyngeal carcinoma and its significance].
21211520 2011 Increased levels of soluble receptor for advanced glycation end products (sRAGE) and high mobility group box 1 (HMGB1) are associated with death in patients with acute respiratory distress syndrome.
21208063 2011 Age of onset of myocardial infarction: is promoter polymorphism of the RAGE gene implicated?
21197704 2011 Soluble receptor for advanced glycation end products is associated with in-stent restenosis in patients with type 2 diabetes with drug-eluting coronary stents.
21137019 2010 Proteomic studies on receptor for advanced glycation end product variants in idiopathic pulmonary fibrosis and chronic obstructive pulmonary disease.
21127710 2010 Evidence for activation of Toll-like receptor and receptor for advanced glycation end products in preterm birth.
21126167 2011 The Receptor for Advanced Glycation End-products (RAGE) protects pancreatic tumor cells against oxidative injury.
21115116 2011 Pigment epithelium-derived factor (PEDF) inhibits proximal tubular cell injury in early diabetic nephropathy by suppressing advanced glycation end products (AGEs)-receptor (RAGE) axis.
21089112 2010 Soluble receptors for advanced glycation end products (sRAGE) as a predictor of restenosis following percutaneous coronary intervention.
21086782 2010 Concentrations of sRAGE in serum and follicular fluid in assisted reproductive cycles--a preliminary study.
21080832 2011 AGE-RAGE in multiple sclerosis brain.
21072897 2010 MK615 decreases RAGE expression and inhibits TAGE-induced proliferation in hepatocellular carcinoma cells.
21067572 2010 Association analysis of nine candidate gene polymorphisms in Indian patients with type 2 diabetic retinopathy.
21067489 2010 Diabetic retinopathy: Validation study of ALR2, RAGE, iNOS and TNFB gene variants in a south Indian cohort.
20947022 2010 Structural basis for ligand recognition and activation of RAGE.
20943659 2010 The 1.5 Å crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
20928981 2010 [Role of the receptor for advanced glycation end products (RAGE) in inflammation].
20847094 2010 Effect of circulating soluble receptor for advanced glycation end products (sRAGE) and the proinflammatory RAGE ligand (EN-RAGE, S100A12) on mortality in hemodialysis patients.
20817881 2010 Complement C3a, CpG oligos, and DNA/C3a complex stimulate IFN-? production in a receptor for advanced glycation end product-dependent manner.
20739563 2010 Microglial receptor for advanced glycation end product-dependent signal pathway drives beta-amyloid-induced synaptic depression and long-term depression impairment in entorhinal cortex.
20732329 2010 Intertwined structured and unstructured regions of exRAGE identified by monitoring hydrogen-deuterium exchange.
20726326 2009 Association of the receptor for advanced glycation end products (RAGE) -374 T/A gene polymorphism and circulating soluble RAGE with nephropathy in type 1 diabetic patients.
20701913 2010 Receptor for advanced glycation endproducts mediates pro-atherogenic responses to periodontal infection in vascular endothelial cells.
20685137 Role of advanced glycation end product receptors in the pathogenesis of diabetic retinopathy.
20684319 2010 [Differential expressions of the receptor for advanced glycation end products in prostate cancer and normal prostate].
20668462 2010 Association of polymorphisms in the RAGE gene with serum CRP levels and coronary artery disease in the Chinese Han population.
20650982 2011 Surfactant protein B and RAGE increases in the plasma during cardiopulmonary bypass: a pilot study.
20631986 2010 The RAGE axis in systemic inflammation, acute lung injury and myocardial dysfunction: an important therapeutic target?
20630999 2010 Involvement of RAGE, NADPH oxidase, and Ras/Raf-1 pathway in glycated LDL-induced expression of heat shock factor-1 and plasminogen activator inhibitor-1 in vascular endothelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627100 2010 Soluble receptor for advanced glycation end products (sRAGE) in plasma and synovial fluid is inversely associated with disease severity of knee osteoarthritis.
20595148 2011 Reduced soluble receptor for advanced glycation end-products in COPD.
20578941 2010 Tissue-specific expression profiling of receptor for advanced glycation end products and its soluble forms in esophageal and lung cancer.
20568058 2010 The functional polymorphisms -429T>C and -374T>A of the RAGE gene promoter are not associated with gestational diabetes in Euro-Brazilians.
20567859 2010 Association of the RAGE G82S polymorphism with Alzheimer's disease.
20541603 2010 Determinants of thromboxane biosynthesis in rheumatoid arthritis: Role of RAGE and oxidant stress.
20537326 2010 Implication of the RAGE-EN-RAGE axis in endometriosis.
20522598 2010 Higher plasma soluble Receptor for Advanced Glycation End Products (sRAGE) levels are associated with incident cardiovascular disease and all-cause mortality in type 1 diabetes: a 12-year follow-up study.
20512925 2010 Carboxylated N-glycans on RAGE promote S100A12 binding and signaling.
20507991 2010 Advanced glycation end product (AGE)-receptor for AGE (RAGE) signaling and up-regulation of Egr-1 in hypoxic macrophages.
20504772 2010 Homodimerization is essential for the receptor for advanced glycation end products (RAGE)-mediated signal transduction.
20492604 2010 Advanced glycation end products on stored red blood cells increase endothelial reactive oxygen species generation through interaction with receptor for advanced glycation end products.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20414834 2010 The role of HMGB1/RAGE in inflammatory cardiomyopathy.
20410680 2010 The -374A allele of the RAGE gene as a potential protective factor for vascular complications in type 2 diabetes: a meta-analysis.
20398646 2010 Soluble receptor for advanced glycation end-products (sRAGE) and polymorphisms of RAGE and glyoxalase I genes in patients with pancreas cancer.
20372816 2010 Resveratrol prevents the impairment of advanced glycosylation end products (AGE) on macrophage lipid homeostasis by suppressing the receptor for AGE via peroxisome proliferator-activated receptor gamma activation.
20359471 2010 Association of biochemical parameters and RAGE gene polymorphisms in healthy infants and their mothers.
20359119 2009 [Expression of RAGE in laryngeal squamous cell carcinoma and clinical significance].
20353610 2010 Association analysis of ADPRT1, AKR1B1, RAGE, GFPT2 and PAI-1 gene polymorphisms with chronic renal insufficiency among Asian Indians with type-2 diabetes.
20215707 2010 Advanced glycation end product-mediated matrix metallo-proteinase-9 and apoptosis via renin-angiotensin system in type 2 diabetes.
20185929 2010 Genetic predisposition to advanced glycation end products toxicity is related to prognosis of chronic hemodialysis patients.
20171262 2010 PLC/CAMK IV-NF-kappaB involved in the receptor for advanced glycation end products mediated signaling pathway in human endothelial cells.
20112183 2010 Functional analysis of the common haplotype in the receptor for advanced glycation end-products gene previously identified as a susceptibility factor for diabetic nephropathy.
20093728 2009 RAGE and S100 protein transcription levels are highly variable in human melanoma tumors and cells.
20074734 2010 Circulating soluble receptor for advanced glycation end-product levels are decreased in patients with calcific aortic valve stenosis.
20051912 2010 The association between the -374T/A polymorphism of the receptor for advanced glycation endproducts gene and blood pressure and arterial stiffness is modified by glucose metabolism status: the Hoorn and CoDAM studies.
20040351 2010 Relation between polymorphisms of receptor for advanced glycation end products (RAGE) and cardiovascular diseases in Chinese patients with diabetic nephropathy.
20031245 2010 Plasma sRAGE is independently associated with high sensitivity C-reactive protein in type 2 diabetes without coronary artery disease.
20028726 2010 Fueling inflammation at tumor microenvironment: the role of multiligand/RAGE axis.
20028692 2010 Regulation of alternative splicing of the receptor for advanced glycation endproducts (RAGE) through G-rich cis-elements and heterogenous nuclear ribonucleoprotein H.
20023238 Associations of -374T/A polymorphism of receptor for advanced glycation end products (RAGE) gene in Turkish diabetic and non-diabetic patients with coronary artery disease.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
20010834 2010 Genome-wide association study identifies five loci associated with lung function.
19998499 2009 Role of the receptor for advanced glycation end products in hepatic fibrosis.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19945761 2010 Plasma sRAGE is not associated with urinary microalbumin excretion in type 2 diabetic nephropathy at the early stage.
19944695 2010 Advanced glycation end products increase endothelial permeability through the RAGE/Rho signaling pathway.
19924100 2010 Circulating soluble receptor of advanced glycation end product inversely correlates with atherosclerosis in patients with chronic kidney disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910580 2010 S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction.
19909734 2010 Soluble receptor for advanced glycation end products in physiological and pathological pregnancy.
19906677 2010 RAGE-dependent signaling in microglia contributes to neuroinflammation, Abeta accumulation, and impaired learning/memory in a mouse model of Alzheimer's disease.
19902324 2010 Association between the RAGE G82S polymorphism and Alzheimer's disease.
19890027 2009 Association of polymorphism in the receptor for advanced glycation end products (RAGE) gene with circulating RAGE levels.
19876719 2010 The expression of HMGB1 protein and its receptor RAGE in human malignant tumors.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19834494 2010 The receptor for advanced glycation end products (RAGE) sustains autophagy and limits apoptosis, promoting pancreatic tumor cell survival.
19822091 Molecular study of receptor for advanced glycation endproduct gene promoter and identification of specific HLA haplotypes possibly involved in chronic fatigue syndrome.
19820033 2009 Protection against loss of innate defenses in adulthood by low advanced glycation end products (AGE) intake: role of the antiinflammatory AGE receptor-1.
19815443 2009 Differential effect of plasma or erythrocyte AGE-ligands of RAGE on expression of transcripts for receptor isoforms.
19786934 2009 Circulating levels of a soluble form of receptor for advanced glycation end products and high-mobility group box chromosomal protein 1 in patients with acute pancreatitis.
19766904 2009 RAGE gene polymorphisms are associated with circulating levels of endogenous secretory RAGE but not with coronary artery disease in Chinese patients with type 2 diabetes mellitus.
19679874 2009 Characterization of RAGE, HMGB1, and S100beta in inflammation-induced preterm birth and fetal tissue injury.
19672558 2009 Ectodomain shedding of the receptor for advanced glycation end products: a novel therapeutic target for Alzheimer's disease.
19659809 2009 Confirmation of the novel association at the BTNL2 locus with ulcerative colitis.
19635564 2010 Irbesartan inhibits advanced glycation end product (AGE)-induced proximal tubular cell injury in vitro by suppressing receptor for AGEs (RAGE) expression.
19616266 2009 Factors associated with serum high mobility group box 1 (HMGB1) levels in a general population.
19591173 2009 RAGE expression and NF-kappaB activation attenuated by extracellular domain of RAGE in human salivary gland cell line.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19576587 2009 Receptor for advanced glycation end products (RAGE) and its inflammatory ligand EN-RAGE in non-diabetic subjects with pre-mature coronary artery disease.
19571577 2009 Advanced glycation end products induce calcification of vascular smooth muscle cells through RAGE/p38 MAPK.
19542745 2009 Association of 1704G/T and G82S polymorphisms in the receptor for advanced glycation end products gene with diabetic retinopathy in Chinese population.
19530996 2009 Damage-associated molecular patterns--emerging targets for biologic therapy of childhood arthritides.
19501570 2009 Minimum stable structure of the receptor for advanced glycation end product possesses multi ligand binding ability.
19451748 2009 Plasma concentrations of high-mobility group box protein 1, soluble receptor for advanced glycation end-products and circulating DNA in patients with acute pancreatitis.
19448391 2009 Advanced glycation end products and their circulating receptors predict cardiovascular disease mortality in older community-dwelling women.
19440065 2009 Plasma levels of soluble receptor for advanced glycation end products are associated with endothelial function and predict cardiovascular events in nondiabetic patients.
19439163 2009 Decreased serum esRAGE level is associated with angiographically determined coronary plaque progression in diabetic patients.
19405075 2009 Advanced glycation end products in diabetic patients with optimized glycaemic control and their effects on endothelial reactivity: possible implications in venous graft failure.
19386136 2009 Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function.
19380826 2009 Amyloid beta interaction with receptor for advanced glycation end products up-regulates brain endothelial CCR5 expression and promotes T cells crossing the blood-brain barrier.
19380603 2009 Advanced glycation end products subspecies-selectively induce adhesion molecule expression and cytokine production in human peripheral blood mononuclear cells.
19376511 2010 The measurements of RAGE, VEGF, and AGEs in the plasma and follicular fluid of reproductive women: the influence of aging.
19332646 2009 RAGE regulates BACE1 and Abeta generation via NFAT1 activation in Alzheimer's disease animal model.
19285601 2009 G allele at RAGE SNP82 is associated with proinflammatory markers in obese subjects.
19284577 2009 Serum levels of soluble receptor for advanced glycation end products and of S100 proteins are associated with inflammatory, autoantibody, and classical risk markers of joint and vascular damage in rheumatoid arthritis.
19277685 2009 Receptor for advanced glycation end products is upregulated in optic neuropathy of Alzheimer's disease.
19275767 2009 RAGE: a novel biological and genetic marker for vascular disease.
19252206 2009 Elevated serum advanced glycation end products and their circulating receptors are associated with anaemia in older community-dwelling women.
19248116 2009 Interleukin-7 stimulates secretion of S100A4 by activating the JAK/STAT signaling pathway in human articular chondrocytes.
19217891 2009 Decreased plasma levels of soluble receptor for advanced glycation endproducts (sRAGE) in patients with nonalcoholic fatty liver disease.
19217461 2009 Independent determinants of soluble form of receptor for advanced glycation end products in elderly hypertensive patients.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19201044 2010 C-reactive protein (CRP) up-regulates expression of receptor for advanced glycation end products (RAGE) and its inflammatory ligand EN-RAGE in THP-1 cells: inhibitory effects of atorvastatin.
19183936 2009 Levels of soluble receptor for AGE are cross-sectionally associated with cardiovascular disease in type 1 diabetes, and this association is partially mediated by endothelial and renal dysfunction and by low-grade inflammation: the EURODIAB Prospective Complications Study.
19167759 2009 HLA-association of serum levels of natural antibodies.
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
19143681 2009 Glycation endproducts, soluble receptor for advanced glycation endproducts and cytokines in diabetic and non-diabetic pregnancies.
19133252 2009 RAGE polymorphisms, renal function and histological finding at 12 months after renal transplantation.
19129693 2009 Angiotensin II upregulates RAGE expression on podocytes: role of AT2 receptors.
19103440 2009 A new pathophysiological aspect of S100B in schizophrenia: potential regulation of S100B by its scavenger soluble RAGE.
19088375 2008 Concentrations of receptor for advanced glycation end products, VEGF and CML in plasma, follicular fluid, and peritoneal fluid in women with and without endometriosis.
19087540 2008 [Correlation between the expression of high mobility group box 1 and receptor for advanced glycation end products and the onset of pre-eclampsia].
19071026 2009 Neuronal RAGE expression modulates severity of injury following transient focal cerebral ischemia.
19061941 2009 Cloning, characterisation, and comparative quantitative expression analyses of receptor for advanced glycation end products (RAGE) transcript forms.
19032093 2008 Solution structure of the variable-type domain of the receptor for advanced glycation end products: new insight into AGE-RAGE interaction.
19023628 2009 Expression of receptor for advanced glycation end products (RAGE) is related to prognosis in patients with esophageal squamous cell carcinoma.
19005067 2008 The HMGB1 receptor RAGE mediates ischemic brain damage.
18987644 2009 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18952609 2008 Receptor for advanced glycation end products is subjected to protein ectodomain shedding by metalloproteinases.
18948101 2008 RAGE signaling contributes to neuroinflammation in infantile neuronal ceroid lipofuscinosis.
18926539 2009 Serum endogenous secretory RAGE level is an independent risk factor for the progression of carotid atherosclerosis in type 1 diabetes.
18922799 2008 Interaction of the RAGE cytoplasmic domain with diaphanous-1 is required for ligand-stimulated cellular migration through activation of Rac1 and Cdc42.
18854308 2008 Distinct roles of heterogeneous nuclear ribonuclear protein K and microRNA-16 in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products.
18825489 2009 Clinical significance of serum HMGB-1 and sRAGE levels in systemic sclerosis: association with disease severity.
18796298 2008 Polymorphisms in advanced glycosylation end product-specific receptor (AGER) gene, insulin resistance, and type 2 diabetes mellitus.
18789567 2009 Advanced glycation end products and their circulating receptors and level of kidney function in older community-dwelling women.
18777492 2008 Endogenous secretory RAGE but not soluble RAGE is associated with carotid atherosclerosis in type 1 diabetes patients.
18775683 2008 Receptor for advanced glycation end products and neuronal deficit in the fatal brain edema of diabetic ketoacidosis.
18701333 2008 Severity of diabetic microvascular complications is associated with a low soluble RAGE level.
18698218 2008 Endogenous soluble receptor for advanced glycation endproducts is increased in preeclampsia.
18689872 2008 RAGE, carboxylated glycans and S100A8/A9 play essential roles in colitis-associated carcinogenesis.
18667420 2008 Structural basis for pattern recognition by the receptor for advanced glycation end products (RAGE).
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18657529 2008 Hippocampal RAGE immunoreactivity in early and advanced Alzheimer's disease.
18645306 2008 Effects of extracellular matrix glycosylation on proliferation and apoptosis of human dermal fibroblasts via the receptor for advanced glycosylated end products.
18615900 2008 Soluble RAGE, diabetic nephropathy and genetic variability in the AGER gene.
18606705 2008 Chemotactic activity of S100A7 (Psoriasin) is mediated by the receptor for advanced glycation end products and potentiates inflammation with highly homologous but functionally distinct S100A15.
18603587 2008 A soluble form of the receptor for advanced glycation endproducts (RAGE) is produced by proteolytic cleavage of the membrane-bound form by the sheddase a disintegrin and metalloprotease 10 (ADAM10).
18595673 2009 Circulating soluble receptor for advanced glycation end products is inversely associated with body mass index and waist/hip ratio in the general population.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18576917 2008 Advanced oxidation protein products activate vascular endothelial cells via a RAGE-mediated signaling pathway.
18575614 2008 Association between LTA, TNF and AGER polymorphisms and late diabetic complications.
18550199 2008 Increased serum endogenous secretory receptor for advanced glycation end-product (esRAGE) levels in type 2 diabetic patients with decreased renal function.
18519797 2008 Gly82Ser polymorphism of the receptor for advanced glycation end products is associated with an increased risk of gastric cancer in a Chinese population.
18480271 2008 Site-specific blockade of RAGE-Vd prevents amyloid-beta oligomer neurotoxicity.
18477569 2008 RAGE expression in the human peritoneal membrane.
18458846 2008 Advanced glycation end products enhance the proliferation and activation of hepatic stellate cells.
18438937 2008 Expression of the receptor for advanced glycation end products in oligodendrocytes in response to oxidative stress.
18431028 2007 Reduced expression of endogenous secretory receptor for advanced glycation endproducts in hippocampal neurons of Alzheimer's disease brains.
18427074 2008 Reduced RAGE mRNA in mononuclear blood cells of patients with probable Alzheimer disease.
18421017 2008 Loss of RAGE in pulmonary fibrosis: molecular relations to functional changes in pulmonary cell types.
18355449 2008 Calcium-regulated intramembrane proteolysis of the RAGE receptor.
18339893 2008 S100A8/A9 at low concentration promotes tumor cell growth via RAGE ligation and MAP kinase-dependent pathway.
18322992 2008 Serum amyloid A activates nuclear factor-kappaB in rheumatoid synovial fibroblasts through binding to receptor of advanced glycation end-products.
18302220 2008 V domain of RAGE interacts with AGEs on prostate carcinoma cells.
18279705 2008 The -374T/A RAGE polymorphism protects against future cardiac events in nondiabetic patients with coronary artery disease.
18279703 2008 Expression of CD64, CD206, and RAGE in adherent cells of diabetic patients infected with Mycobacterium tuberculosis.
18256374 2008 Endothelial dysfunction in patients with chronic kidney disease results from advanced glycation end products (AGE)-mediated inhibition of endothelial nitric oxide synthase through RAGE activation.
18245812 2008 A role for the receptor for advanced glycation end products in idiopathic pulmonary fibrosis.
18231794 2008 Decreased levels of soluble receptor for advanced glycation end products in patients with primary Sjögren's syndrome.
18179750 The -374T/A variant of the rage gene promoter is associated with clinical restenosis after coronary stent placement.
18089847 2008 Identification, classification, and expression of RAGE gene splice variants.
18080716 2008 A novel function of the receptor for advanced glycation end-products (RAGE) in association with tumorigenesis and tumor differentiation of HCC.
18079965 2008 Vascular and inflammatory stresses mediate atherosclerosis via RAGE and its ligands in apoE-/- mice.
18079485 2008 Receptor for advanced glycation end product polymorphisms and type 2 diabetes: the CODAM study.
18078623 RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro.
18058469 2007 Receptor for advanced glycation end products (RAGE)--soluble form (sRAGE) and gene polymorphisms in patients with breast cancer.
18050248 2007 Acute Kawasaki disease is associated with reverse regulation of soluble receptor for advance glycation end products and its proinflammatory ligand S100A12.
18046662 2007 sRAGE and esRAGE are not associated with peripheral or autonomic neuropathy in type 2 diabetes.
18032526 2008 AGE-receptor-1 counteracts cellular oxidant stress induced by AGEs via negative regulation of p66shc-dependent FKHRL1 phosphorylation.
17924846 2007 The -374A allele of the receptor for advanced glycation end products (RAGE) gene promoter is a protective factor against cardiovascular lesions in type 2 diabetes mellitus patients.
17726019 2007 S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains.
17714874 2007 De-N-glycosylation or G82S mutation of RAGE sensitizes its interaction with advanced glycation endproducts.
17700210 2007 Genetic polymorphism in the pregnancy-associated plasma protein-A associated with acute myocardial infarction.
17661837 2007 Relationship between the -374T/A receptor of advanced glycation end products gene polymorphism and peritoneal solute transport status at the initiation of peritoneal dialysis.
17660747 2007 Structural and functional insights into RAGE activation by multimeric S100B.
17640970 2007 RAGE expression in rhabdomyosarcoma cells results in myogenic differentiation and reduced proliferation, migration, invasiveness, and tumor growth.
17639302 2007 Thiazolidinedione increases serum soluble receptor for advanced glycation end-products in type 2 diabetes.
17613396 2007 Plasma receptor for advanced glycation end-products predicts duration of ICU stay and mechanical ventilation in patients after lung transplantation.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17593216 2007 Receptor for advanced glycation end products (RAGE) is important in the prediction of recurrence in human oral squamous cell carcinoma.
17592553 Serum levels of sRAGE, the soluble form of receptor for advanced glycation end products, are associated with inflammatory markers in patients with type 2 diabetes.
17588956 2007 Distribution of the receptor for advanced glycation end products in the human male reproductive tract: prevalence in men with diabetes mellitus.
17560613 2008 Olmesartan blocks advanced glycation end products (AGEs)-induced angiogenesis in vitro by suppressing receptor for AGEs (RAGE) expression.
17549666 Usefulness of CDK5RAP3, CCNB2, and RAGE genes for the diagnosis of lung adenocarcinoma.
17536039 2007 Soluble RAGE blocks scavenger receptor CD36-mediated uptake of hypochlorite-modified low-density lipoprotein.
17512509 2007 The -429 T>C polymorphism of the receptor for advanced glycation end products (RAGE) is associated with type 1 diabetes in a Brazilian population.
17508727 2007 The extracellular region of the receptor for advanced glycation end products is composed of two independent structural units.
17497647 2007 Endogenous secretory receptor for advanced glycation endproducts as a novel prognostic marker in chondrosarcoma.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17434489 2007 Advanced glycation end products increases matrix metalloproteinase-1, -3, and -13, and TNF-alpha in human osteoarthritic chondrocytes.
17425804 2007 Receptor for advanced glycation end products Glycine 82 Serine polymorphism and risk of cardiovascular events in rheumatoid arthritis.
17405935 2007 Immunomorphological analysis of RAGE receptor expression and NF-kappaB activation in tissue samples from normal and degenerated intervertebral discs of various ages.
17355942 2007 [Association of Gly82Ser polymorphism of receptor for advanced glycation end products gene in a type 2 diabetic Chinese population].
17345061 2007 Genetic risk factors for diabetic nephropathy on chromosomes 6p and 7q identified by the set-association approach.
17343760 2007 Soluble RAGE but not endogenous secretory RAGE is associated with albuminuria in patients with type 2 diabetes.
17237617 2007 Pregnancy-associated plasma protein a and soluble receptor for advanced glycation end products after kidney transplantation.
17224333 2007 Association of the Gly82Ser polymorphism in the receptor for advanced glycation end products (RAGE) gene with circulating levels of soluble RAGE and inflammatory markers in nondiabetic and nonobese Koreans.
17218539 2007 Hypochlorite-modified albumin colocalizes with RAGE in the artery wall and promotes MCP-1 expression via the RAGE-Erk1/2 MAP-kinase pathway.
17172923 2007 Association of RAGE gene polymorphisms with coronary artery disease in the Korean population.
17170388 2007 Expression of receptor for advanced glycation end products in sarcoid granulomas.
17158877 2007 Hexameric calgranulin C (S100A12) binds to the receptor for advanced glycated end products (RAGE) using symmetric hydrophobic target-binding patches.
17035340 2007 The secretion of HMGB1 is required for the migration of maturing dendritic cells.
17024691 2007 Elevation of soluble form of receptor for advanced glycation end products (sRAGE) in diabetic subjects with coronary artery disease.
17004092 2006 Telmisartan inhibits AGE-induced C-reactive protein production through downregulation of the receptor for AGE via peroxisome proliferator-activated receptor-gamma activation.
16969649 2006 Association between serum levels of soluble receptor for advanced glycation end products and circulating advanced glycation end products in type 2 diabetes.
16969646 2006 The -374 T/A polymorphism in the gene encoding RAGE is associated with diabetic nephropathy and retinopathy in type 1 diabetic patients.
16954682 2007 Association of RAGE gene polymorphisms with in-stent restenosis in non-diabetic Korean population.
16954185 2006 Advanced glycation end product (AGE) receptor 1 suppresses cell oxidant stress and activation signaling via EGF receptor.
16899960 2006 Modulation of RAGE expression influences the adhesion of red blood cells from diabetic patients.
16847147 2006 C-Reactive protein upregulates receptor for advanced glycation end products expression in human endothelial cells.
16788244 2006 Non classical HLA genes and non-HLA genes in a population of infants at familial risk of atopy.
16728681 2006 Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke.
16716307 2006 In vitro inhibition of transthyretin aggregate-induced cytotoxicity by full and peptide derived forms of the soluble receptor for advanced glycation end products (RAGE).
16644647 2006 Plasma sRAGE is independently associated with urinary albumin excretion in type 2 diabetes.
16493495 2006 Interaction of Nepsilon(carboxymethyl)lysine- and methylglyoxal-modified albumin with endothelial cells and macrophages. Splice variants of RAGE may limit the responsiveness of human endothelial cells to AGEs.
16440015 2007 Rage gene promoter polymorphisms and diabetic retinopathy in a clinic-based population from South India.
16374460 2006 The receptor for advanced glycation end products is highly expressed in the skin and upregulated by advanced glycation end products and tumor necrosis factor-alpha.
16305072 2005 RAGE polymorphisms and the heritability of insulin resistance: the Leeds family study.
16286548 2005 Circulating levels of soluble receptor for advanced glycation end products in Alzheimer disease and vascular dementia.
16271939 2005 Telmisartan inhibits expression of a receptor for advanced glycation end products (RAGE) in angiotensin-II-exposed endothelial cells and decreases serum levels of soluble RAGE in patients with essential hypertension.
16166741 2006 Proliferative stimulus of lung fibroblasts on lung cancer cells is impaired by the receptor for advanced glycation end-products.
16159602 2005 The RAGE Gly82Ser polymorphism is not associated with cardiovascular disease in the Framingham offspring study.
16127291 2005 Association of expression of receptor for advanced glycation end products and invasive activity of oral squamous cell carcinoma.
16061848 2005 S100P promotes pancreatic cancer growth, survival, and invasion.
16052547 2005 Articular chondrocytes express the receptor for advanced glycation end products: Potential role in osteoarthritis.
16037279 2005 Receptor for advanced glycation end products is a promising target of diabetic nephropathy.
15986224 2005 The RAGE pathway in inflammatory myopathies and limb girdle muscular dystrophy.
15944249 2005 Release of high mobility group box 1 by dendritic cells controls T cell activation via the receptor for advanced glycation end products.
15942086 2005 Relation between polymorphisms G1704T and G82S of rage gene and diabetic retinopathy in Japanese type 2 diabetic patients.
15942078 2005 Relation between polymorphisms G1704T and G82S of RAGE gene and diabetic retinopathy in Japanese type 2 diabetic patients.
15930093 2005 Modulation of soluble receptor for advanced glycation end products by angiotensin-converting enzyme-1 inhibition in diabetic nephropathy.
15926115 2005 The AGE/RAGE/NF-(kappa)B pathway may contribute to the pathogenesis of polyneuropathy in impaired glucose tolerance (IGT).
15915542 2005 Requirement of HMGB1 and RAGE for the maturation of human plasmacytoid dendritic cells.
15911356 2005 Altered intracellular signaling and reduced viability of Alzheimer's disease neuronal cybrids is reproduced by beta-amyloid peptide acting through receptor for advanced glycation end products (RAGE).
15896660 2005 The -374A allele of the receptor for advanced glycation end products gene is associated with a decreased risk of ischemic heart disease in African-Brazilians with type 2 diabetes.
15893388 2005 The role of reactive oxygen species in TNFalpha-dependent expression of the receptor for advanced glycation end products in human umbilical vein endothelial cells.
15803111 2005 Polymorphisms of the receptor of advanced glycation endproducts (RAGE) and the development of nephropathy in type 1 diabetic patients.
15798956 2005 Association study of G1704T and G82S polymorphisms of RAGE gene for microalbuminuria in Japanese type 2 diabetic patients.
15790669 2005 Haplotype analysis of the RAGE gene: identification of a haplotype marker for diabetic nephropathy in type 2 diabetes mellitus.
15748606 2005 -374T/A polymorphism of the RAGE gene promoter in relation to severity of coronary atherosclerosis.
15666591 2004 The -429 T/C and -374 T/A gene polymorphisms of the receptor of advanced glycation end products gene (RAGE) are not risk factors for coronary artery disease in Slovene population with type 2 diabetes.
15666359 2005 Receptor for advanced glycation end products (RAGE) and its ligand, amphoterin are overexpressed and associated with prostate cancer development.
15663911 2005 Atherosclerosis and restenosis: is there a role for RAGE?
15599399 2004 Loss of pain perception in diabetes is dependent on a receptor of the immunoglobulin superfamily.
15555779 2005 Splice variants of the receptor for advanced glycosylation end products (RAGE) in human brain.
15547674 2004 Relationship between the -374T/A RAGE gene polymorphism and angiographic coronary artery disease.
15539404 2005 Down-regulation of the receptor for advanced glycation end-products (RAGE) supports non-small cell lung carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448098 2004 Thiazolidinediones reduce endothelial expression of receptors for advanced glycation end products.
15289604 2004 Advanced glycation endproduct (AGE) receptor 1 is a negative regulator of the inflammatory response to AGE in mesangial cells.
15247020 2004 RAGE: a new pleiotropic antagonistic gene?
15239215 Expression of receptor for advanced glycation end products (RAGE) and MMP-9 in human pancreatic cancer cells.
15213278 2004 Enhanced expression of receptor for advanced glycation end products in chronic kidney disease.
15203887 Increased expression of tissue factor and receptor for advanced glycation end products in peripheral blood mononuclear cells of patients with type 2 diabetes mellitus with vascular complications.
15180953 2004 RAGE- and TGF-beta receptor-mediated signals converge on STAT5 and p21waf to control cell-cycle progression of mesangial cells: a possible role in the development and progression of diabetic nephropathy.
15170618 2004 Receptor for advanced glycation endproduct (RAGE)-mediated nuclear factor-kappaB activation in vasculitic neuropathy.
15155381 2004 RAGE axis: Animal models and novel insights into the vascular complications of diabetes.
15127201 2004 Binding of receptor for advanced glycation end products (RAGE) ligands is not sufficient to induce inflammatory signals: lack of activity of endotoxin-free albumin-derived advanced glycation end products.
15053925 2004 Overexpression of receptor of advanced glycation end products hypersensitizes cells for amyloid beta peptide-induced cell death.
15052533 2004 A 63bp deletion in the promoter of rage correlates with a decreased risk for nephropathy in patients with type 2 diabetes.
15033494 2004 S100 protein translocation in response to extracellular S100 is mediated by receptor for advanced glycation endproducts in human endothelial cells.
15019601 AGE down-regulation of monocyte RAGE expression and its association with diabetic complications in type 1 diabetes.
15009731 2004 Regulation of human melanoma growth and metastasis by AGE-AGE receptor interactions.
14747204 2004 Relation between development of nephropathy and the p22phox C242T and receptor for advanced glycation end product G1704T gene polymorphisms in type 2 diabetic patients.
14704946 2003 The - 429 T/C and - 374 T/A gene polymorphisms of the receptor of advanced glycation end products gene are not risk factors for diabetic retinopathy in Caucasians with type 2 diabetes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14617629 2004 S100P stimulates cell proliferation and survival via receptor for activated glycation end products (RAGE).
14595542 2003 Oleate, not ligands of the receptor for advanced glycation end-products, promotes proliferation of human arterial smooth muscle cells.
14580673 2003 Tissue-specific expression patterns of the RAGE receptor and its soluble forms--a result of regulated alternative splicing?
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14571699 Expression of receptor for advanced glycation end products (RAGE) in human biliary cancer cells.
14501001 2003 Relationship between the induction of RAGE cell-surface antigen and the expression of amyloid binding sites.
12941744 2003 -429T/C and -374T/A polymorphisms of RAGE gene promoter are not associated with diabetic retinopathy in Chinese patients with type 2 diabetes.
12935895 2003 The receptor for advanced glycation end-products (RAGE) directly binds to ERK by a D-domain-like docking site.
12909002 2003 The receptor for advanced glycation end products (RAGE) is elevated in women with preeclampsia.
12859967 2003 Expression analysis of S100 proteins and RAGE in human tumors using tissue microarrays.
12837757 2003 Regulation of cyclooxygenase-2 expression in monocytes by ligation of the receptor for advanced glycation end products.
12671312 1998 RAGE-Abeta interactions in the pathophysiology of Alzheimer's disease.
12651613 2003 Advanced glycation end products and receptor for advanced glycation end products in AA amyloidosis.
12618340 2003 RAGE is expressed in pyramidal cells of the hippocampus following moderate hypoxic-ischemic brain injury in rats.
12606536 2003 The functional -374 T/A RAGE gene polymorphism is associated with proteinuria and cardiovascular disease in type 1 diabetic patients.
12598893 2003 Suppression of experimental autoimmune encephalomyelitis by selective blockade of encephalitogenic T-cell infiltration of the central nervous system.
12579287 Co-expression of receptor for advanced glycation end products and the ligand amphoterin associates closely with metastasis of colorectal cancer.
12495433 2003 Novel splice variants of the receptor for advanced glycation end-products expressed in human vascular endothelial cells and pericytes, and their putative roles in diabetes-induced vascular injury.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477623 Association of Gly82Ser polymorphism in the RAGE gene with diabetic retinopathy in type II diabetic Asian Indian patients.
12475402 2002 [Expression of receptors for advanced glycation end products at surface of peripheral blood monocytes and relationship thereof to plasma proinflammatory cytokines in patients undergoing hemodialysis].
12070776 2002 RAGE and arthritis: the G82S polymorphism amplifies the inflammatory response.
12029499 2002 Gene polymorphisms (G82S, 1704G/T, 2184A/G and 2245G/A) of the receptor of advanced glycation end products (RAGE) in plaque psoriasis.
11961018 2002 Receptor for advanced glycation end products on human synovial fibroblasts: role in the pathogenesis of dialysis-related amyloidosis.
11884895 2002 Polymorphisms 1704G/T, 2184A/G, and 2245G/A in the rage gene are not associated with diabetic retinopathy in NIDDM: pilot study.
11811511 2001 Distribution of the receptor for advanced glycation end products gene polymorphisms in patients with chronic periodontitis: a preliminary study.
11586486 2001 Polymorphisms 1704G/T and 2184A/G in the RAGE gene are associated with antioxidant status.
11457670 Polymorphisms in the RAGE gene influence susceptibility to diabetes-associated microvascular dermatoses in NIDDM.
11375354 2001 Effects of novel polymorphisms in the RAGE gene on transcriptional regulation and their association with diabetic retinopathy.
11334430 2001 Polymorphism screening of four genes encoding advanced glycation end-product putative receptors. Association study with nephropathy in type 1 diabetic patients.
11282423 2001 A novel polymorphism in the promoter of the RAGE gene is associated with non-small cell lung cancer.
11007787 2000 Coregulation of neurite outgrowth and cell survival by amphoterin and S100 proteins through receptor for advanced glycation end products (RAGE) activation.
10835680 2000 Receptor-dependent cell stress and amyloid accumulation in systemic amyloidosis.
10531386 1999 N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.
10521570 1999 cDNA cloning of a novel secreted isoform of the human receptor for advanced glycation end products and characterization of cells co-expressing cell-surface scavenger receptors and Swedish mutant amyloid precursor protein.
10399917 1999 RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides.
10391939 1999 Receptor for advanced glycation end products (RAGE)-mediated neurite outgrowth and activation of NF-kappaB require the cytoplasmic domain of the receptor but different downstream signaling pathways.
9812979 1998 Sp1-binding elements in the promoter of RAGE are essential for amphoterin-mediated gene expression in cultured neuroblastoma cells.
9734395 1998 Suppression of accelerated diabetic atherosclerosis by the soluble receptor for advanced glycation endproducts.
9195959 1997 Characterization and functional analysis of the promoter of RAGE, the receptor for advanced glycation end products.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8787669 1996 The receptor for advanced glycation end products (RAGE) is a central mediator of the interaction of AGE-beta2microglobulin with human mononuclear phagocytes via an oxidant-sensitive pathway. Implications for the pathogenesis of dialysis-related amyloidosis.
8751438 1996 RAGE and amyloid-beta peptide neurotoxicity in Alzheimer's disease.
7887450 1995 Expression of receptors for advanced glycation end products in peripheral occlusive vascular disease.
7835890 1994 Three genes in the human MHC class III region near the junction with the class II: gene for receptor of advanced glycosylation end products, PBX2 homeobox gene and a notch homolog, human counterpart of mouse mammary tumor gene int-3.
7713518 1994 Localization of the human gene for advanced glycosylation end product-specific receptor (AGER) to chromosome 6p21.3.
1378843 1992 Cloning and expression of a cell surface receptor for advanced glycosylation end products of proteins.