Property Summary

Ligand Count 4
NCBI Gene PubMed Count 769
PubMed Score 187.34
PubTator Score 748.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-03
glioblastoma -1.100 4.3e-04
lung adenocarcinoma -3.300 7.1e-15
lung cancer -1.500 3.8e-04
lung carcinoma -4.400 6.7e-41
malignant mesothelioma 1.500 1.5e-04
non-small cell lung cancer -5.703 4.8e-43
osteosarcoma -2.083 1.3e-06
psoriasis -1.200 1.3e-03

PDB (22)

Gene RIF (725)

AA Sequence

MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGG      1 - 70
PWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNK     71 - 140
VGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSF    141 - 210
SPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPL    211 - 280
PPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGG    281 - 350
LGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP                    351 - 404
//

Text Mined References (771)

PMID Year Title