Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.84
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.700 5.1e-06
atypical teratoid / rhabdoid tumor -1.300 2.7e-05
medulloblastoma, large-cell -1.800 1.1e-04
primitive neuroectodermal tumor -1.300 8.7e-04
diabetes mellitus 1.200 1.0e-03
pediatric high grade glioma -1.400 6.4e-05
pilocytic astrocytoma -1.200 7.0e-04
lung carcinoma 2.600 4.8e-25
ovarian cancer -1.400 2.0e-04
psoriasis -2.000 2.5e-39

Gene RIF (4)

PMID Text
25472652 AGBL4 promoter hypermethylation is associated with Colorectal Cancer.
25416787 Nna1 and CCP4 remove the C-terminal glutamate from substrates with two or more glutamates, whereas CCP6 requires four or more glutamates. CCP4 behaves as a promiscuous glutamase with little preference for chain length or neighboring amino acid composition
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQVSEFEYDLFI      1 - 70
RPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCP     71 - 140
DHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITS    141 - 210
PDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYR    211 - 280
CSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQ    281 - 350
RQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTE    351 - 420
EAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNSKGDK    421 - 490
KSSVNHKDPSTPF                                                             491 - 503
//

Text Mined References (9)

PMID Year Title
25472652 2015 Clinical Relevance of Plasma DNA Methylation in Colorectal Cancer Patients Identified by Using a Genome-Wide High-Resolution Array.
25416787 2015 Comparison of the enzymatic and functional properties of three cytosolic carboxypeptidase family members.
23085998 2013 Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs).
21074048 2010 A family of protein-deglutamylating enzymes associated with neurodegeneration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.