Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.02
PubTator Score 28.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.300 1.2e-16
glioblastoma multiforme -1.500 5.0e-17
oligodendroglioma -1.400 2.6e-18
osteosarcoma 1.154 3.0e-05
posterior fossa group B ependymoma -1.700 1.6e-05
sonic hedgehog group medulloblastoma -1.200 8.5e-06
atypical teratoid / rhabdoid tumor -1.500 4.9e-10
primitive neuroectodermal tumor -1.500 1.3e-05
breast carcinoma 1.200 4.1e-02
adult high grade glioma -1.700 1.6e-02
pilocytic astrocytoma -1.200 2.2e-02
subependymal giant cell astrocytoma -2.414 1.1e-02

Gene RIF (2)

PMID Text
23904596 AGAP3 is an essential signaling component of the NMDA receptor complex that links NMDA receptor activation to AMPA receptor trafficking.
14506264 M-RIP can assemble a complex containing both RhoA and Myosin phosphatase myosin binding subunit, suggesting that M-RIP may play a role in myosin phosphatase regulation by RhoA

AA Sequence

MNFQAGGGQSPQQQQQLAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHV      1 - 70
ISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL     71 - 140
LIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVI    141 - 210
DDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASI    211 - 280
PAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDRE    281 - 350
KKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLL    351 - 420
RTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPE    421 - 490
GLHQRSCSVSSADQWSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGP    491 - 560
SSATEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQNAALAVQ    561 - 630
AVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNA    631 - 700
LANSVWEGALGGYSKPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLA    701 - 770
HGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQ    771 - 840
HGCPGEGCGLAPTPNREPANGTNPSAELHRSPSLL                                       841 - 875
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904596 2013 AGAP3 and Arf6 regulate trafficking of AMPA receptors and synaptic plasticity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16461359 2006 A novel GTPase, CRAG, mediates promyelocytic leukemia protein-associated nuclear body formation and degradation of expanded polyglutamine protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15381706 2004 AGAP1, a novel binding partner of nitric oxide-sensitive guanylyl cyclase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506264 2003 Myosin phosphatase-Rho interacting protein. A new member of the myosin phosphatase complex that directly binds RhoA.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12640130 2003 GGAPs, a new family of bifunctional GTP-binding and GTPase-activating proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.