Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.19
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.200 2.0e-02
astrocytic glioma -1.400 3.5e-02
ependymoma -2.000 1.5e-10
cutaneous lupus erythematosus -1.500 5.8e-03
atypical teratoid / rhabdoid tumor -1.700 5.9e-04
glioblastoma -1.600 2.0e-04
medulloblastoma, large-cell 1.500 1.7e-03
primitive neuroectodermal tumor 1.600 3.5e-03
tuberculosis and treatment for 6 months 1.900 7.7e-04
Breast cancer 3.800 2.6e-02
adult high grade glioma -1.600 2.2e-04
pancreatic carcinoma -1.200 2.0e-02
subependymal giant cell astrocytoma -3.185 3.6e-03
invasive ductal carcinoma -1.006 4.3e-03
Down syndrome 1.100 2.9e-02

 MGI Phenotype (1)

Gene RIF (8)

PMID Text
25496667 Genome-wide shRNA screening identifies AGAP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22453919 GTP-binding protein-like domain of AGAP1 is protein binding site that allosterically regulates ArfGAP protein catalytic activity.
18003747 AGAP1 is unique among the AZAPs in its specificity for Arf1, and this activity is dependent on its NH(2)-terminal GTPase-like domain. AGAP1 induce reciprocal activation of Arf6.
16079295 The AGAP1 has been found to associate with the adaptor protein complex AP-3 and regulate the function of AP-3 endosomes.
15892143 Observational study of gene-disease association. (HuGE Navigator)
15892143 CENTG2 is an intriguing candidate gene that merits further scrutiny for its role in autism.
15381706 AGAP1 is a novel binding partner of nitric oxide-sensitive guanylyl cyclase
12388557 overexpression inhibited formation of platelet-derived growth factor-induced ruffles and also induced loss of actin stress fibers

AA Sequence

MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVP      1 - 70
ELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAV     71 - 140
IFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYET    141 - 210
CATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSS    211 - 280
SVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQ    281 - 350
GMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI    351 - 420
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQWSEATVIANS    421 - 490
AISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVS    491 - 560
LTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQ    561 - 630
NPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPS    631 - 700
VDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGR    701 - 770
TALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS    771 - 840
RRNNNRNNSSGRVPTII                                                         841 - 857
//

Text Mined References (24)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22453919 2012 GTP-binding protein-like domain of AGAP1 is protein binding site that allosterically regulates ArfGAP protein catalytic activity.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
18954304 2009 A BAR domain-mediated autoinhibitory mechanism for RhoGAPs of the GRAF family.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18003747 2008 Substrate specificities and activities of AZAP family Arf GAPs in vivo.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16341674 2005 Transcriptome analysis of human gastric cancer.
16079295 2005 The Arf GAPs AGAP1 and AGAP2 distinguish between the adaptor protein complexes AP-1 and AP-3.
15892143 2005 Evaluation of the chromosome 2q37.3 gene CENTG2 as an autism susceptibility gene.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381706 2004 AGAP1, a novel binding partner of nitric oxide-sensitive guanylyl cyclase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12967569 2003 Specific regulation of the adaptor protein complex AP-3 by the Arf GAP AGAP1.
12640130 2003 GGAPs, a new family of bifunctional GTP-binding and GTPase-activating proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388557 2002 AGAP1, an endosome-associated, phosphoinositide-dependent ADP-ribosylation factor GTPase-activating protein that affects actin cytoskeleton.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.