Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.83
PubTator Score 3.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
breast carcinoma 1.200 9.6e-04
ductal carcinoma in situ 1.100 1.2e-03
juvenile dermatomyositis 1.046 2.8e-12
medulloblastoma, large-cell -1.300 1.5e-03
osteosarcoma -2.244 7.0e-08

 GO Function (1)

 GO Process (1)

Gene RIF (2)

AA Sequence

MEPDIIRMYSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDYTRPKEEFVPSNHFMPIHE      1 - 70
FSENVDSLTSFKSIKNGNDKDITAELSAPVKGQSDVLLSTTSKEIISSEMLATSIDGMERPGNLNKVVEQ     71 - 140
RQNVGTLESFSPGDFRTNMNVVHQNKQLESCNGEKPPCLEILTNGFAVLETVNPQGTDDLDNVADSKGRK    141 - 210
PLSTHSTEYNLDSVPSPAEEFADFATFSKKERIQLEEIECAVLNDREALTIRENNKINRVNELNSVKEVA    211 - 280
LGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSKAWSLVDSADNSEAIRRE    281 - 350
QCKTEEKLDLLTSKCAHLCMDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSND    351 - 420
FVTCNDINEDDFGDFGDFGSASGSTPPFVTGTQDSMSDATFEESSEHFPHFSEPGDDFGEFGDINAVSCQ    421 - 490
EETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFDSVPNIQDDCNGFQDSDDFAD    491 - 560
FSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKG    561 - 630
AVASGHLQESATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLD    631 - 700
VWTELQDIHDAHGLRYQWGGSHSNKKLLSSLGIDTRNILFTGNKKQPVIVPMYAAGLGMLEPTKEPLKPL    701 - 770
SAAEKIASIGQTATMSPDMNTCTSDQFQESLPPVQFDWSSSGLTNPLDASGGSTLLNLDFFGPVDDSSSS    771 - 840
SSTTIPGVDPELYELTTSKLEISTSSLKVTDAFARLMSTVEKTSTSTSRKPKREEHLSEEAIKVIAGLPD    841 - 910
LTFMHAKVLMFPATLTPSTSSQEKADG                                               911 - 937
//

Text Mined References (19)

PMID Year Title