Property Summary

NCBI Gene PubMed Count 27
PubMed Score 159.73
PubTator Score 424.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count P-value
psoriasis 6685 5.1e-07
nephrosclerosis 329 5.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1795 1.5e-02
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Trigonitis 1 4.676 2.3
Squamous papillomatosis 1 4.366 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.888 5.6e-03
pancreatic ductal adenocarcinoma liver m... -2.518 1.5e-02
psoriasis -1.700 5.1e-07

Gene RIF (9)

PMID Text
25208973 Data suggest that up-regulation of AFM levels in serum in women with polycystic ovary syndrome can be used as a biological markers of those women with increased risk of developing metabolic syndrome, especially those with insulin resistance.
24768783 A linear increase in afamin during pregnancy may serve as basic reference for subsequent investigations of afamin in pregnancy-related disorders.
20858448 Afamin levels were altered significantly in the peritoneal fluid of women with endometriosis compared with disease-free controls.
19336561 Reduced Afamin expression is associated with ovarian cancer.
19046407 afamin might be a new family member of binding/transport proteins contributing to alpha-tocopherol homeostasis at the blood-brain barrier
18976975 Knockdown of afamin (AFM) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15952736 vitamin E-binding properties were confirmed; found abundant presence of this protein in plasma, extravascular fluids such as follicular, and cerebrospinal fluids
12463752 The protein structure of afamin has been determined by homology modeling and its in vitro binding properties confirmed by docking calculations on the proposed structure.
12063119 Binding of bilirubin with human serum albumin was studied by absorption, fluorescence and CD spectroscopy

AA Sequence

MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDM      1 - 70
VEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFP     71 - 140
TLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPVT    141 - 210
QYLKAFSSYQKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRD    211 - 280
TSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTF    281 - 350
FAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ    351 - 420
NLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRT    421 - 490
INPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHE    491 - 560
LTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN                                   561 - 599
//

Text Mined References (33)

PMID Year Title
25208973 2014 Afamin serum concentrations are associated with insulin resistance and metabolic syndrome in polycystic ovary syndrome.
24768783 2014 The vitamin E-binding protein afamin increases in maternal serum during pregnancy.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21269460 2011 Initial characterization of the human central proteome.
20858448 2010 The vitamin E-binding protein afamin is altered significantly in the peritoneal fluid of women with endometriosis.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19336561 2009 Afamin and apolipoprotein A-IV: novel protein markers for ovarian cancer.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19046407 2009 Afamin is synthesized by cerebrovascular endothelial cells and mediates alpha-tocopherol transport across an in vitro model of the blood-brain barrier.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
15952736 Afamin is a novel human vitamin E-binding glycoprotein characterization and in vitro expression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463752 2002 Characterization of the vitamin E-binding properties of human plasma afamin.
12063119 2002 Bilirubin binding properties of pigeon serum albumin and its comparison with human serum albumin.
10400926 1999 Physical and meiotic mapping of the region of human chromosome 4q11-q13 encompassing the vitamin D binding protein DBP/Gc-globulin and albumin multigene cluster.
8755513 1996 Complete structure of the human alpha-albumin gene, a new member of the serum albumin multigene family.
8648639 1996 Tandem arrangement of the human serum albumin multigene family in the sub-centromeric region of 4q: evolution and chromosomal direction of transcription.
7875606 1995 Identification of rat alpha-albumin and cDNA cloning of its human ortholog.
7517938 1994 Afamin is a new member of the albumin, alpha-fetoprotein, and vitamin D-binding protein gene family.
7035619 1982 Glial cells identified by anti-alpha-albumin (anti-GFA) in human pineal gland.
4041902 1985 Primary cultures from defined brain areas; effects of seeding time on cell growth, astroglial content and protein synthesis.
37276 1979 A two-site immunoradiometric assay for the determination of alpha-albumin.