Property Summary

NCBI Gene PubMed Count 25
PubMed Score 39.88
PubTator Score 30.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
malignant mesothelioma 3232 2.4e-06
ulcerative colitis 1819 6.2e-06
interstitial cystitis 2312 4.9e-04
oligodendroglioma 2850 1.0e-03
ovarian cancer 8520 1.9e-02
astrocytic glioma 2597 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chronic progressive external ophthalmoplegia 26 3.532 1.8
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 3.483 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 4.2e-02
interstitial cystitis -1.100 4.9e-04
malignant mesothelioma 1.200 2.4e-06
oligodendroglioma 1.200 1.0e-03
ovarian cancer 1.200 1.9e-02
ulcerative colitis -1.200 6.2e-06

Gene RIF (15)

AA Sequence

MAHRCLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVTTQARASRNSLLTDIIAAYQRFCSRPP      1 - 70
KGFEKYFPNGKNGKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGGKKDDSHWWSRFQKGDIPWDD     71 - 140
KDFRMFFLWTALFWGGVMFYLLLKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQ    141 - 210
YVWFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGR    211 - 280
TGRGMGGLFSVGETTAKVLKDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPP    281 - 350
GTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGN    351 - 420
FGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVH    421 - 490
LRPLKLDSTLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKT    491 - 560
QVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLG    561 - 630
GRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDE    631 - 700
VRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDT    701 - 770
SLPEGLKDWNKEREKEKEEPPGEKVAN                                               771 - 797
//

Text Mined References (29)

PMID Year Title