Property Summary

NCBI Gene PubMed Count 31
PubMed Score 25.30
PubTator Score 18.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.300 1.9e-02
Astrocytoma, Pilocytic -1.800 8.6e-06
Atopic dermatitis -1.500 3.8e-03
atypical teratoid / rhabdoid tumor 1.600 4.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.194 4.8e-03
cystic fibrosis -1.686 5.9e-06
glioblastoma -1.400 8.8e-04
group 3 medulloblastoma -2.500 5.3e-03
interstitial cystitis -1.700 5.5e-03
interstitial lung disease -1.100 7.7e-03
lung adenocarcinoma -1.500 3.6e-11
lung cancer -1.100 8.6e-03
lung carcinoma -2.800 2.1e-25
medulloblastoma, large-cell -3.000 9.5e-03
nasopharyngeal carcinoma -1.600 4.2e-04
non-small cell lung cancer -3.247 3.7e-26
osteosarcoma -2.836 8.7e-03
ovarian cancer -1.800 4.9e-10
pancreatic cancer -1.200 1.7e-02
pancreatic carcinoma -1.200 1.7e-02
primary Sjogren syndrome 1.900 2.3e-04
progressive supranuclear palsy 1.400 2.3e-02
psoriasis -1.300 1.5e-21
subependymal giant cell astrocytoma -3.854 1.0e-02
tuberculosis 1.600 1.1e-03

 GO Function (1)

Gene RIF (16)

AA Sequence

MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQ      1 - 70
NTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQ     71 - 140
SKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSG    141 - 210
HCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAK    211 - 280
LSKFSIPKQGEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGD    281 - 350
AEPESPDSGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG    351 - 420
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHG    421 - 490
SESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSA    491 - 560
AAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGTSVVVPPEPTKTRPC    561 - 630
GNNRASHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASA    631 - 700
SSGNDQRLKEAAANGGSGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKI    701 - 770
DLTLLSRIPEHLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD    771 - 840
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTS    841 - 910
ASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMPRSADYF    911 - 980
MQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSG    981 - 1050
PNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPM   1051 - 1120
SPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFN   1121 - 1190
DLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS                                     1191 - 1226
//

Text Mined References (33)

PMID Year Title