Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.46
PubTator Score 18.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.3e-05
atypical teratoid / rhabdoid tumor -1.100 5.8e-04
Breast cancer -1.200 2.1e-07
cystic fibrosis -1.047 5.9e-05
group 3 medulloblastoma -2.000 8.7e-05
intraductal papillary-mucinous adenoma (... -1.200 2.0e-03
intraductal papillary-mucinous carcinoma... -1.500 8.8e-03
ovarian cancer 1.400 7.5e-05
psoriasis 1.300 9.4e-31

Gene RIF (15)

AA Sequence

MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAES      1 - 70
QGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEA     71 - 140
VSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSK    141 - 210
DHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEG    211 - 280
NQYTPDAQRFNCQKPDIAEKYLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPV    281 - 350
ERSLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK    351 - 420
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYI    421 - 490
DGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSFLHGPSSAQAQASSP    491 - 560
TLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLESLEPEDPSLRITTVKIQTEQQRISFPPSCPD    561 - 630
AVVATPPGASPPVKDRLRVTSAEIKLGKNRTEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETL    631 - 700
LKCTDKEVLASLEQKLKEIDEECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENVSPRP    701 - 770
KAVTPASAPDCTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS                          771 - 818
//

Text Mined References (30)

PMID Year Title